Recombinant Human ABCA6 Protein, GST-Tagged
| Cat.No. : | ABCA6-035H |
| Product Overview : | Human ABCA6 partial ORF ( NP_525023, 53 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24 and may play a role in macrophage lipid homeostasis. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.41 kDa |
| AA Sequence : | NVQFPGMAPQNLGRVDKFNSSSLMVVYTPISNLTQQIMNKTALAPLLKGTSVIGAPNKTHMDEILLENLPYAMGIIFNETFSYKLIFFQGYNSPLWK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ABCA6 ATP-binding cassette, sub-family A (ABC1), member 6 [ Homo sapiens ] |
| Official Symbol | ABCA6 |
| Synonyms | ABCA6; ATP-binding cassette, sub-family A (ABC1), member 6; ATP-binding cassette sub-family A member 6; EST155051; ABC transporter ABCA6; ATP-binding cassette A6; FLJ43498; |
| Gene ID | 23460 |
| mRNA Refseq | NM_080284 |
| Protein Refseq | NP_525023 |
| MIM | 612504 |
| UniProt ID | Q8N139 |
| ◆ Recombinant Proteins | ||
| ABCA6-752HF | Recombinant Full Length Human ABCA6 Protein, GST-tagged | +Inquiry |
| Abca6-8140M | Recombinant Mouse Abca6 protein, His & T7-tagged | +Inquiry |
| ABCA6-035H | Recombinant Human ABCA6 Protein, GST-Tagged | +Inquiry |
| ABCA6-183M | Recombinant Mouse ABCA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ABCA6-1082M | Recombinant Mouse ABCA6 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCA6 Products
Required fields are marked with *
My Review for All ABCA6 Products
Required fields are marked with *
