Recombinant Human ABCA6 Protein, GST-Tagged

Cat.No. : ABCA6-035H
Product Overview : Human ABCA6 partial ORF ( NP_525023, 53 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24 and may play a role in macrophage lipid homeostasis. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.41 kDa
AA Sequence : NVQFPGMAPQNLGRVDKFNSSSLMVVYTPISNLTQQIMNKTALAPLLKGTSVIGAPNKTHMDEILLENLPYAMGIIFNETFSYKLIFFQGYNSPLWK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCA6 ATP-binding cassette, sub-family A (ABC1), member 6 [ Homo sapiens ]
Official Symbol ABCA6
Synonyms ABCA6; ATP-binding cassette, sub-family A (ABC1), member 6; ATP-binding cassette sub-family A member 6; EST155051; ABC transporter ABCA6; ATP-binding cassette A6; FLJ43498;
Gene ID 23460
mRNA Refseq NM_080284
Protein Refseq NP_525023
MIM 612504
UniProt ID Q8N139

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCA6 Products

Required fields are marked with *

My Review for All ABCA6 Products

Required fields are marked with *

0
cart-icon