Recombinant Human ABCB1 Protein, GST-Tagged
| Cat.No. : | ABCB1-037H |
| Product Overview : | Human ABCB1 partial ORF ( NP_000918, 620 a.a. - 709 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. Mutations in this gene are associated with colchicine resistance and Inflammatory bowel disease 13. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Feb 2017] |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | GIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ABCB1 ATP-binding cassette, sub-family B (MDR/TAP), member 1 [ Homo sapiens ] |
| Official Symbol | ABCB1 |
| Synonyms | ABCB1; ATP-binding cassette, sub-family B (MDR/TAP), member 1; CLCS, colchicin sensitivity , MDR1, PGY1; multidrug resistance protein 1; ABC20; CD243; GP170; P gp; P-glycoprotein 1; colchicin sensitivity; doxorubicin resistance; CLCS; MDR1; P-GP; PGY1; |
| Gene ID | 5243 |
| mRNA Refseq | NM_000927 |
| Protein Refseq | NP_000918 |
| MIM | 171050 |
| UniProt ID | P08183 |
| ◆ Recombinant Proteins | ||
| HLA-DRB1-13822H | Recombinant Human HLA-DRB1, GST-tagged | +Inquiry |
| ABCB1-151H | Recombinant Human ABCB1 protein, His-tagged | +Inquiry |
| ABCB1-9C | Recombinant Cynomolgus Monkey ABCB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ABCB1-115H | Recombinant Human ABCB1 Protein, His-tagged | +Inquiry |
| ABCB1-177R | Recombinant Rhesus monkey ABCB1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCB1 Products
Required fields are marked with *
My Review for All ABCB1 Products
Required fields are marked with *
