Recombinant Human ABCB1 protein, GST-tagged
Cat.No. : | ABCB1-6744H |
Product Overview : | Recombinant Human ABCB1 protein(624-708 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 624-708 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | KLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEW |
Gene Name | ABCB1 ATP-binding cassette, sub-family B (MDR/TAP), member 1 [ Homo sapiens ] |
Official Symbol | ABCB1 |
Synonyms | ABCB1; ATP-binding cassette, sub-family B (MDR/TAP), member 1; CLCS, colchicin sensitivity , MDR1, PGY1; multidrug resistance protein 1; ABC20; CD243; GP170; P gp; P-glycoprotein 1; colchicin sensitivity; doxorubicin resistance; CLCS; MDR1; P-GP; PGY1; |
Gene ID | 5243 |
mRNA Refseq | NM_000927 |
Protein Refseq | NP_000918 |
MIM | 171050 |
UniProt ID | P08183 |
◆ Recombinant Proteins | ||
ABCB1-9C | Recombinant Cynomolgus Monkey ABCB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCB1-259C | Recombinant Cynomolgus ABCB1 Protein, His-tagged | +Inquiry |
HLA-DRB1-13822H | Recombinant Human HLA-DRB1, GST-tagged | +Inquiry |
ABCB1-6744H | Recombinant Human ABCB1 protein, GST-tagged | +Inquiry |
ABCB1-2549H | Recombinant Human ABCB1, His-tagged | +Inquiry |
◆ Native Proteins | ||
ABCB1-10H | Recombinant Human TMPRSS3 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCB1 Products
Required fields are marked with *
My Review for All ABCB1 Products
Required fields are marked with *