Recombinant Human ABCB1 protein, His-tagged
| Cat.No. : | ABCB1-9207H |
| Product Overview : | Recombinant Human ABCB1 protein(624-708 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | June 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 624-708 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | KLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEW |
| Gene Name | ABCB1 ATP-binding cassette, sub-family B (MDR/TAP), member 1 [ Homo sapiens ] |
| Official Symbol | ABCB1 |
| Synonyms | ABCB1; ATP-binding cassette, sub-family B (MDR/TAP), member 1; CLCS, colchicin sensitivity , MDR1, PGY1; multidrug resistance protein 1; ABC20; CD243; GP170; P gp; P-glycoprotein 1; colchicin sensitivity; doxorubicin resistance; CLCS; MDR1; P-GP; PGY1; |
| Gene ID | 5243 |
| mRNA Refseq | NM_000927 |
| Protein Refseq | NP_000918 |
| MIM | 171050 |
| UniProt ID | P08183 |
| ◆ Recombinant Proteins | ||
| ALK-29H | Recombinant Human ALK (G1202R), GST-tagged | +Inquiry |
| ALK-58H | Recombinant Human ALK (C1156Y), GST-tagged | +Inquiry |
| ALK-16M | Recombinant Macaca nemestrina ALK Protein | +Inquiry |
| ALK-473H | Recombinant Human ALK Protein, GST-tagged | +Inquiry |
| ALK-318H | Recombinant Human ALK Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALK Products
Required fields are marked with *
My Review for All ALK Products
Required fields are marked with *
