Recombinant Human ALK Protein, GST-tagged
Cat.No. : | ALK-473H |
Product Overview : | Human ALK partial ORF ( NP_004295, 251 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 251 a.a. - 350 a.a. |
Description : | This gene encodes a receptor tyrosine kinase, which belongs to the insulin receptor superfamily. This protein comprises an extracellular domain, an hydrophobic stretch corresponding to a single pass transmembrane region, and an intracellular kinase domain. It plays an important role in the development of the brain and exerts its effects on specific neurons in the nervous system. This gene has been found to be rearranged, mutated, or amplified in a series of tumours including anaplastic large cell lymphomas, neuroblastoma, and non-small cell lung cancer. The chromosomal rearrangements are the most common genetic alterations in this gene, which result in creation of multiple fusion genes in tumourigenesis, including ALK (chromosome 2)/EML4 (chromosome 2), ALK/RANBP2 (chromosome 2), ALK/ATIC (chromosome 2), ALK/TFG (chromosome 3), ALK/NPM1 (chromosome 5), ALK/SQSTM1 (chromosome 5), ALK/KIF5B (chromosome 10), ALK/CLTC (chromosome 17), ALK/TPM4 (chromosome 19), and ALK/MSN (chromosome X).[provided by RefSeq, Jan 2011] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | DSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALK anaplastic lymphoma receptor tyrosine kinase [ Homo sapiens ] |
Official Symbol | ALK |
Synonyms | ALK; anaplastic lymphoma receptor tyrosine kinase; anaplastic lymphoma kinase (Ki 1); ALK tyrosine kinase receptor; CD246; CD246 antigen; mutant anaplastic lymphoma kinase; NBLST3; |
Gene ID | 238 |
mRNA Refseq | NM_004304 |
Protein Refseq | NP_004295 |
MIM | 105590 |
UniProt ID | Q9UM73 |
◆ Recombinant Proteins | ||
ALK25121H | Recombinant Human ALK (1069-1396) Protein, GST-tagged | +Inquiry |
ALK-16M | Recombinant Macaca nemestrina ALK Protein | +Inquiry |
ALK-10H | Recombinant Human ALK, His-tagged | +Inquiry |
ALK-28H | Recombinant Human ALK (F1174L), GST-tagged | +Inquiry |
ALK-14H | Recombinant Human ALK (L1196M), GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALK Products
Required fields are marked with *
My Review for All ALK Products
Required fields are marked with *