Recombinant Human ABCB5 protein, His-tagged
| Cat.No. : | ABCB5-3533H |
| Product Overview : | Recombinant Human ABCB5 protein(138-257 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 138-257 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | LSTIRSADLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLLKILKLNKPEWPFVVLGTLASVLN |
| Gene Name | ABCB5 ATP-binding cassette, sub-family B (MDR/TAP), member 5 [ Homo sapiens ] |
| Official Symbol | ABCB5 |
| Synonyms | ABCB5; ATP-binding cassette, sub-family B (MDR/TAP), member 5; ATP-binding cassette sub-family B member 5; ABCB5alpha; ABCB5beta; ATP binding cassette protein; EST422562; P glycoprotein ABCB5; ABCB5 P-gp; P-glycoprotein ABCB5; ATP-binding cassette protein; |
| Gene ID | 340273 |
| mRNA Refseq | NM_001163941 |
| Protein Refseq | NP_001157413 |
| MIM | 611785 |
| UniProt ID | Q2M3G0 |
| ◆ Recombinant Proteins | ||
| ABCB5-150H | Recombinant Human ABCB5 protein, Trx-His-tagged | +Inquiry |
| ABCB5-0418H | Recombinant Human ABCB5 Protein (Ala570-Ala808), N-His-tagged | +Inquiry |
| ABCB5-1092M | Recombinant Mouse ABCB5 Protein | +Inquiry |
| ABCB5-039H | Recombinant Human ABCB5 Protein | +Inquiry |
| ABCB5-9209H | Recombinant Human ABCB5, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABCB5-9152HCL | Recombinant Human ABCB5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCB5 Products
Required fields are marked with *
My Review for All ABCB5 Products
Required fields are marked with *



