Recombinant Human ABCB5 protein, Trx-His-tagged
Cat.No. : | ABCB5-150H |
Product Overview : | Recombinant Human ABCB5 fused with Trx-His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Trx |
Description : | ABCB5 belongs to the ATP-binding cassette (ABC) transporter superfamily of integral membrane proteins. These proteins participate in ATP-dependent transmembrane transport of structurally diverse molecules ranging from small ions, sugars, and peptides to more complex organic molecules (Chen et al., 2005 [PubMed 15760339]). |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 29.4kD |
AA Sequence : | MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAIRSADLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLL |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | ABCB5 ATP-binding cassette, sub-family B (MDR/TAP), member 5 [ Homo sapiens ] |
Official Symbol | ABCB5 |
Synonyms | ABCB5; ATP-binding cassette, sub-family B (MDR/TAP), member 5; ATP-binding cassette sub-family B member 5; ABCB5alpha; ABCB5beta; ATP binding cassette protein; EST422562; P glycoprotein ABCB5; ABCB5 P-gp; P-glycoprotein ABCB5; ATP-binding cassette protein; |
Gene ID | 340273 |
mRNA Refseq | NM_178559 |
Protein Refseq | NP_848654 |
MIM | 611785 |
UniProt ID | Q2M3G0 |
◆ Recombinant Proteins | ||
ABCB5-0419H | Recombinant Human ABCB5 Protein (Ile141-Val247), N-Trx-tagged | +Inquiry |
ABCB5-9209H | Recombinant Human ABCB5, His-tagged | +Inquiry |
ABCB5-3534H | Recombinant Human ABCB5 protein, GST-tagged | +Inquiry |
ABCB5-1092M | Recombinant Mouse ABCB5 Protein | +Inquiry |
ABCB5-039H | Recombinant Human ABCB5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCB5-9152HCL | Recombinant Human ABCB5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCB5 Products
Required fields are marked with *
My Review for All ABCB5 Products
Required fields are marked with *