Recombinant Human ABCB7 protein, GST-tagged
Cat.No. : | ABCB7-24H |
Product Overview : | Recombinant Human ABCB7 protein(25-173 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 25-173 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | AILIRPLVSVSGSGPQWRPHQLGALGTARAYQQIPESLKSITWQRLGKGNSGQFLDAAKALQVWPLIEKRTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMS |
Gene Name | ABCB7 ATP-binding cassette, sub-family B (MDR/TAP), member 7 [ Homo sapiens ] |
Official Symbol | ABCB7 |
Synonyms | ABCB7; ATP-binding cassette, sub-family B (MDR/TAP), member 7; ABC7; ATP-binding cassette sub-family B member 7, mitochondrial; ASAT; Atm1p; EST140535; ATP-binding cassette 7; ABC transporter 7 protein; ATP-binding cassette transporter 7; |
Gene ID | 22 |
mRNA Refseq | NM_004299 |
Protein Refseq | NP_004290 |
MIM | 300135 |
UniProt ID | O75027 |
◆ Recombinant Proteins | ||
ABI1-6322H | Recombinant Human ABI1 protein, His-tagged | +Inquiry |
ABI1-1779H | Recombinant Human ABI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ABI1-3344C | Recombinant Chicken ABI1 | +Inquiry |
ABI1-086H | Recombinant Human ABI1 Protein, GST-Tagged | +Inquiry |
Abi1-501M | Recombinant Mouse Abi1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABI1-9129HCL | Recombinant Human ABI1 293 Cell Lysate | +Inquiry |
ABI1-9128HCL | Recombinant Human ABI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABI1 Products
Required fields are marked with *
My Review for All ABI1 Products
Required fields are marked with *