Recombinant Human ABI1 Protein, GST-Tagged
Cat.No. : | ABI1-086H |
Product Overview : | Human ABI1 partial ORF ( NP_001012770, 185 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14. [provided by RefSeq, Sep 2011] |
Molecular Mass : | 31.68 kDa |
AA Sequence : | GTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABI1 abl-interactor 1 [ Homo sapiens ] |
Official Symbol | ABI1 |
Synonyms | ABI1; abl-interactor 1; spectrin SH3 domain binding protein 1 , SSH3BP1; abl interactor 1; ABI 1; E3B1; Abelson interactor 1; nap1 binding protein; abl-binding protein 4; interactor protein AblBP4; Abl-interactor protein 1 long; eps8 SH3 domain-binding protein; spectrin SH3 domain-binding protein 1; ABI-1; ABLBP4; NAP1BP; SSH3BP; SSH3BP1; |
Gene ID | 10006 |
mRNA Refseq | NM_001012750 |
Protein Refseq | NP_001012768 |
MIM | 603050 |
UniProt ID | Q8IZP0 |
◆ Recombinant Proteins | ||
ABI1-0537H | Recombinant Human ABI1 Protein (Met1-Pro182), N-His-tagged | +Inquiry |
ABI1-890HF | Recombinant Full Length Human ABI1 Protein, GST-tagged | +Inquiry |
ABI1-1704H | Recombinant Human ABI1 protein, His & T7-tagged | +Inquiry |
TUBA1B-38H | Recombinant Human TUBA1B protein, His-tagged | +Inquiry |
Serpinf1-1120R | Recombinant Rat Serpinf1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABI1-9129HCL | Recombinant Human ABI1 293 Cell Lysate | +Inquiry |
ABI1-9128HCL | Recombinant Human ABI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABI1 Products
Required fields are marked with *
My Review for All ABI1 Products
Required fields are marked with *
0
Inquiry Basket