Recombinant Human ABCC11 Protein, GST-Tagged

Cat.No. : ABCC11-045H
Product Overview : Human ABCC11 partial ORF ( NP_115972.2, 433 a.a. - 532 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This ABC full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. The product of this gene participates in physiological processes involving bile acids, conjugated steroids, and cyclic nucleotides. In addition, a SNP in this gene is responsible for determination of human earwax type. This gene and family member ABCC12 are determined to be derived by duplication and are both localized to chromosome 16q12.1. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : FVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCC11 ATP-binding cassette, sub-family C (CFTR/MRP), member 11 [ Homo sapiens ]
Official Symbol ABCC11
Synonyms ABCC11; ATP-binding cassette, sub-family C (CFTR/MRP), member 11; ATP-binding cassette sub-family C member 11; MRP8; multi-resistance protein 8; ATP-binding cassette protein C11; ATP-binding cassette transporter MRP8; multidrug resistance-associated protein 8; ATP-binding cassette transporter sub-family C member 11; WW; EWWD;
Gene ID 85320
mRNA Refseq NM_032583
Protein Refseq NP_115972
MIM 607040
UniProt ID Q96J66

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCC11 Products

Required fields are marked with *

My Review for All ABCC11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon