Recombinant Human ABCC5 protein, His-tagged
Cat.No. : | ABCC5-3965H |
Product Overview : | Recombinant Human ABCC5 protein(1-179 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-179 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRL |
Gene Name | ABCC5 ATP-binding cassette, sub-family C (CFTR/MRP), member 5 [ Homo sapiens ] |
Official Symbol | ABCC5 |
Synonyms | ABCC5; ATP-binding cassette, sub-family C (CFTR/MRP), member 5; multidrug resistance-associated protein 5; EST277145; MOAT C; MRP5; SMRP; ATP-binding cassette sub-family C member 5; multi-specific organic anion transporter C; canalicular multispecific organic anion transporter C; ABC33; MOATC; MOAT-C; pABC11; DKFZp686C1782; |
Gene ID | 10057 |
mRNA Refseq | NM_001023587 |
Protein Refseq | NP_001018881 |
MIM | 605251 |
UniProt ID | O15440 |
◆ Recombinant Proteins | ||
ADRBK2-386H | Recombinant Human ADRBK2 Protein, GST-tagged | +Inquiry |
ADRBK2-203R | Recombinant Rat ADRBK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADRBK2-969HF | Recombinant Full Length Human ADRBK2 Protein, GST-tagged | +Inquiry |
ADRBK2-387H | Recombinant Human ADRBK2 Protein, GST-tagged | +Inquiry |
ADRBK2-1179H | Recombinant Human Adrenergic, Beta, Receptor Kinase 2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADRBK2-13HCL | Recombinant Human ADRBK2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADRBK2 Products
Required fields are marked with *
My Review for All ADRBK2 Products
Required fields are marked with *
0
Inquiry Basket