Recombinant Human ABCC6 Protein, GST-Tagged
Cat.No. : | ABCC6-051H |
Product Overview : | Human ABCC6 full-length ORF ( NP_001072996.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.2 kDa |
AA Sequence : | MAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGRGYLRMSPLFKAKMVAAIPGSLEPGNVRGRQGTGWNLVKS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABCC6 ATP-binding cassette, sub-family C (CFTR/MRP), member 6 [ Homo sapiens ] |
Official Symbol | ABCC6 |
Synonyms | ABCC6; ATP-binding cassette, sub-family C (CFTR/MRP), member 6; ARA, pseudoxanthoma elasticum , PXE; URG7 protein; multidrug resistance-associated protein 6; EST349056; MLP1; MRP6; URG7; multidrug resistance-associated protein 6; MOAT-E; ATP-binding cassette sub-family C member 6; multi-specific organic anion transporter E; anthracycline resistance-associated protein; ARA; PXE; PXE1; ABC34; GACI2; MOATE; |
Gene ID | 368 |
mRNA Refseq | NM_001079528 |
Protein Refseq | NP_001072996 |
MIM | 603234 |
UniProt ID | O95255 |
◆ Recombinant Proteins | ||
Abcc6-8121R | Recombinant Rat Abcc6 protein, His & T7-tagged | +Inquiry |
ABCC6-1104M | Recombinant Mouse ABCC6 Protein | +Inquiry |
ABCC6-632H | Recombinant Human ABCC6 | +Inquiry |
ABCC6-052H | Recombinant Human ABCC6 Protein, GST-Tagged | +Inquiry |
ABCC6-200M | Recombinant Mouse ABCC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCC6-6HCL | Recombinant Human ABCC6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC6 Products
Required fields are marked with *
My Review for All ABCC6 Products
Required fields are marked with *
0
Inquiry Basket