Recombinant Human ABCC6 protein, His-tagged
Cat.No. : | ABCC6-9219H |
Product Overview : | Recombinant Human ABCC6 protein(1219-1503 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1219-1503 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | VVRNWTDLENSIVSVERMQDYAWTPKEAPWRLPTCAAQPPWPQGGQIEFRDFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAEGGIWIDGVPIAHVGLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQLKALVASLPGQLQYKCADRGEDLSVGQKQLLCLARALLRKTQILILDEATAAVDPGTELQMQAMLGSWFAQCTVLLIAHRLRSVMDCARVLVMDKGQVAESGSPAQLLAQKGLFYRLAQESGLV |
Gene Name | ABCC6 ATP-binding cassette, sub-family C (CFTR/MRP), member 6 [ Homo sapiens ] |
Official Symbol | ABCC6 |
Synonyms | ABCC6; ATP-binding cassette, sub-family C (CFTR/MRP), member 6; ARA, pseudoxanthoma elasticum , PXE; URG7 protein; multidrug resistance-associated protein 6; EST349056; MLP1; MRP6; URG7; multidrug resistance-associated protein 6; MOAT-E; ATP-binding cassette sub-family C member 6; multi-specific organic anion transporter E; anthracycline resistance-associated protein; ARA; PXE; PXE1; ABC34; GACI2; MOATE; |
Gene ID | 368 |
mRNA Refseq | NM_001079528 |
Protein Refseq | NP_001072996 |
MIM | 603234 |
UniProt ID | O95255 |
◆ Recombinant Proteins | ||
ABCC6-633H | Recombinant Human ABCC6 Protein, His-tagged | +Inquiry |
Abcc6-8120M | Recombinant Mouse Abcc6 protein, His & T7-tagged | +Inquiry |
ABCC6-1104M | Recombinant Mouse ABCC6 Protein | +Inquiry |
ABCC6-4541C | Recombinant Chicken ABCC6 | +Inquiry |
ABCC6-62R | Recombinant Rat ABCC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCC6-6HCL | Recombinant Human ABCC6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC6 Products
Required fields are marked with *
My Review for All ABCC6 Products
Required fields are marked with *