Recombinant Human ABCG2 protein, His-Myc-tagged
Cat.No. : | ABCG2-045H |
Product Overview : | Recombinant Human ABCG2 protein(Q9UNQ0)(557-630aa), fused with C-terminal 6xHis tag and Myc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 557-630aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 12.1 kDa |
AA Sequence : | NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ABCG2 ATP-binding cassette, sub-family G (WHITE), member 2 [ Homo sapiens ] |
Official Symbol | ABCG2 |
Synonyms | ABCG2; ATP-binding cassette, sub-family G (WHITE), member 2; ATP-binding cassette sub-family G member 2; ABCP; BCRP; CD338; EST157481; MXR; ABC transporter; placenta specific MDR protein; breast cancer resistance protein; ATP-binding cassette transporter G2; mitoxantrone resistance-associated protein; placenta-specific ATP-binding cassette transporter; multi drug resistance efflux transport ATP-binding cassette sub-family G (WHITE) member 2; MRX; BMDP; MXR1; ABC15; BCRP1; GOUT1; CDw338; UAQTL1; MGC102821; |
Gene ID | 9429 |
mRNA Refseq | NM_001257386 |
Protein Refseq | NP_001244315 |
MIM | 603756 |
UniProt ID | Q9UNQ0 |
◆ Recombinant Proteins | ||
ABCG2-0160H | Recombinant Human ABCG2 Protein (M1-S655), eGFP, Strep II, 10×His tagged | +Inquiry |
ABCG2-2404H | Recombinant Human ABCG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCG2-414R | Recombinant Rat ABCG2 Protein | +Inquiry |
Abcg2-5673M | Recombinant Mouse Abcg2 protein, His & T7-tagged | +Inquiry |
RFL35359MF | Recombinant Full Length Mouse Atp-Binding Cassette Sub-Family G Member 2(Abcg2) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCG2 Products
Required fields are marked with *
My Review for All ABCG2 Products
Required fields are marked with *
0
Inquiry Basket