Recombinant Human ABCG2 protein, His-Myc-tagged
| Cat.No. : | ABCG2-045H |
| Product Overview : | Recombinant Human ABCG2 protein(Q9UNQ0)(557-630aa), fused with C-terminal 6xHis tag and Myc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His&Myc |
| Protein Length : | 557-630aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 12.1 kDa |
| AA Sequence : | NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ABCG2 ATP-binding cassette, sub-family G (WHITE), member 2 [ Homo sapiens ] |
| Official Symbol | ABCG2 |
| Synonyms | ABCG2; ATP-binding cassette, sub-family G (WHITE), member 2; ATP-binding cassette sub-family G member 2; ABCP; BCRP; CD338; EST157481; MXR; ABC transporter; placenta specific MDR protein; breast cancer resistance protein; ATP-binding cassette transporter G2; mitoxantrone resistance-associated protein; placenta-specific ATP-binding cassette transporter; multi drug resistance efflux transport ATP-binding cassette sub-family G (WHITE) member 2; MRX; BMDP; MXR1; ABC15; BCRP1; GOUT1; CDw338; UAQTL1; MGC102821; |
| Gene ID | 9429 |
| mRNA Refseq | NM_001257386 |
| Protein Refseq | NP_001244315 |
| MIM | 603756 |
| UniProt ID | Q9UNQ0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCG2 Products
Required fields are marked with *
My Review for All ABCG2 Products
Required fields are marked with *



