Recombinant Human ABHD2 Protein, N-His6ABP-tagged
Cat.No. : | ABHD2-03H |
Product Overview : | Recombinant protein of human abhydrolase domain containing 2 (ABHD2) with a N-His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) tag was expreseed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | ABP&His |
Description : | This gene encodes a protein containing an alpha/beta hydrolase fold, which is a catalytic domain found in a wide range of enzymes. The encoded protein is an acylglycerol lipase that catalyzes the hydrolysis of endocannabinoid arachidonoylglycerol from the cell membrane. This leads to activation of the sperm calcium channel CatSper, which results in sperm activation. Alternative splicing of this gene results in two transcript variants encoding the same protein. |
Molecular Mass : | 34 kDa including tags |
AA Sequence : | TALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVL |
Purity : | >80% by SDS-PAGE and Coomassie blue staining |
Applications : | Blocking agent and positive assay control using corresponding antibodies. |
Notes : | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Storage : | Upon delivery store at -20 centigrade. Avoid repeated freeze/thaw cycles. |
Concentration : | ≥0.5 mg/ml |
Storage Buffer : | PBS and 1M Urea, pH 7.4. |
Shipping : | Shipped in liquid form on wet ice. |
Gene Name | ABHD2 abhydrolase domain containing 2, acylglycerol lipase [ Homo sapiens (human) ] |
Official Symbol | ABHD2 |
Synonyms | ABHD2; abhydrolase domain containing 2, acylglycerol lipase; HS1-2; LABH2; PHPS1-2; monoacylglycerol lipase ABHD2; 2-arachidonoylglycerol hydrolase; abhydrolase domain-containing protein 2; acetylesterase; alpha/beta hydrolase domain containing protein 2; lung alpha/beta hydrolase 2; progesterone-sensitive lipase; protein PHPS1-2; testicular tissue protein Li 6; EC 3.1.1.23; EC 3.1.1.6; EC 3.1.1.79 |
Gene ID | 11057 |
mRNA Refseq | NM_152924 |
Protein Refseq | NP_690888 |
MIM | 612196 |
UniProt ID | P08910 |
◆ Recombinant Proteins | ||
ALDH3B1-495H | Recombinant Human ALDH3B1 protein, His-tagged | +Inquiry |
ABHD2-494H | Recombinant Human ABHD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ABHD2-4893H | Recombinant Human ABHD2 protein, MYC/DDK-tagged | +Inquiry |
ABHD2-301H | Recombinant Human ABHD2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Abhd2-1471M | Recombinant Mouse Abhd2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD2-9134HCL | Recombinant Human ABHD2 293 Cell Lysate | +Inquiry |
ABHD2-9135HCL | Recombinant Human ABHD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD2 Products
Required fields are marked with *
My Review for All ABHD2 Products
Required fields are marked with *