Recombinant Human ABI3 Protein, GST-Tagged

• Cat.No.: ABI3-089H
• Product Overview: Human ABI3 partial ORF ( NP_057512.1, 75 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of an adaptor protein family. Members of this family encode proteins containing a homeobox homology domain, proline rich region and Src-homology 3 (SH3) domain, and are components of the Abi/WAVE complex which regulates actin polymerization. The encoded protein inhibits ectopic metastasis of tumor cells as well as cell migration. This may be accomplished through interaction with p21-activated kinase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
• Molecular Mass: 37.62 kDa
• AA Sequence: MLDLQGAALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQRLPPGQKVIAPENLPPLTPYCRRPLNFGCLDDIGHGIKDLSTQLSRTGTLSRKSIKAPATPASATL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABI3 ABI family, member 3 [ Homo sapiens ]
• Official Symbol: ABI3
• Synonyms: ABI3; ABI family, member 3; ABI gene family member 3; NESH; SSH3BP3; ABI gene family, member 3; new molecule including SH3
• Gene ID: 51225
• mRNA Refseq: NM_001135186
• Protein Refseq: NP_001128658
• MIM: 606363
• UniProt ID: Q9P2A4