Recombinant Human ABI3 Protein, GST-Tagged

Cat.No. : ABI3-089H
Product Overview : Human ABI3 partial ORF ( NP_057512.1, 75 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of an adaptor protein family. Members of this family encode proteins containing a homeobox homology domain, proline rich region and Src-homology 3 (SH3) domain, and are components of the Abi/WAVE complex which regulates actin polymerization. The encoded protein inhibits ectopic metastasis of tumor cells as well as cell migration. This may be accomplished through interaction with p21-activated kinase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
Molecular Mass : 37.62 kDa
AA Sequence : MLDLQGAALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQRLPPGQKVIAPENLPPLTPYCRRPLNFGCLDDIGHGIKDLSTQLSRTGTLSRKSIKAPATPASATL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABI3 ABI family, member 3 [ Homo sapiens ]
Official Symbol ABI3
Synonyms ABI3; ABI family, member 3; ABI gene family member 3; NESH; SSH3BP3; ABI gene family, member 3; new molecule including SH3;
Gene ID 51225
mRNA Refseq NM_001135186
Protein Refseq NP_001128658
MIM 606363
UniProt ID Q9P2A4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABI3 Products

Required fields are marked with *

My Review for All ABI3 Products

Required fields are marked with *

0
cart-icon
0
compare icon