Recombinant Human ABL2 Protein, GST-Tagged
Cat.No. : | ABL2-106H |
Product Overview : | Human ABL2 partial ORF ( AAH65912, 743 a.a. - 842 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinases. The protein is highly similar to the c-abl oncogene 1 protein, including the tyrosine kinase, SH2 and SH3 domains, and it plays a role in cytoskeletal rearrangements through its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ets variant 6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Nov 2009] |
Molecular Mass : | 36.41 kDa |
AA Sequence : | KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABL2 v-abl Abelson murine leukemia viral oncogene homolog 2 [ Homo sapiens ] |
Official Symbol | ABL2 |
Synonyms | ABL2; v-abl Abelson murine leukemia viral oncogene homolog 2; ABLL, v abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson related gene); Abelson tyrosine-protein kinase 2; Abelson related gene; ARG; tyrosine-protein kinase ARG; abelson-related gene protein; ABLL; |
Gene ID | 27 |
mRNA Refseq | NM_001136000 |
Protein Refseq | NP_001129472 |
MIM | 164690 |
UniProt ID | P42684 |
◆ Recombinant Proteins | ||
Abl2-502M | Recombinant Mouse Abl2 Protein, MYC/DDK-tagged | +Inquiry |
ARG-3620M | Recombinant Mouse ARG, His-tagged | +Inquiry |
ABL2-673H | Recombinant Human ABL2, GST-tagged | +Inquiry |
ABL2-233H | Active Recombinant Human ABL2, His-tagged | +Inquiry |
ABL2-106H | Recombinant Human ABL2 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABL2-9126HCL | Recombinant Human ABL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABL2 Products
Required fields are marked with *
My Review for All ABL2 Products
Required fields are marked with *
0
Inquiry Basket