Recombinant Human ABL2 Protein, GST-Tagged
| Cat.No. : | ABL2-106H |
| Product Overview : | Human ABL2 partial ORF ( AAH65912, 743 a.a. - 842 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinases. The protein is highly similar to the c-abl oncogene 1 protein, including the tyrosine kinase, SH2 and SH3 domains, and it plays a role in cytoskeletal rearrangements through its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ets variant 6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Nov 2009] |
| Molecular Mass : | 36.41 kDa |
| AA Sequence : | KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ABL2 v-abl Abelson murine leukemia viral oncogene homolog 2 [ Homo sapiens ] |
| Official Symbol | ABL2 |
| Synonyms | ABL2; v-abl Abelson murine leukemia viral oncogene homolog 2; ABLL, v abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson related gene); Abelson tyrosine-protein kinase 2; Abelson related gene; ARG; tyrosine-protein kinase ARG; abelson-related gene protein; ABLL; |
| Gene ID | 27 |
| mRNA Refseq | NM_001136000 |
| Protein Refseq | NP_001129472 |
| MIM | 164690 |
| UniProt ID | P42684 |
| ◆ Recombinant Proteins | ||
| ABL2-9250H | Recombinant Human ABL2 protein, His-tagged | +Inquiry |
| ARG-3620M | Recombinant Mouse ARG, His-tagged | +Inquiry |
| Abl2-502M | Recombinant Mouse Abl2 Protein, MYC/DDK-tagged | +Inquiry |
| Abl2-233M | Recombinant Mouse Abl2, His-tagged, Active | +Inquiry |
| ABL2-5208H | Recombinant Human ABL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABL2-9126HCL | Recombinant Human ABL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABL2 Products
Required fields are marked with *
My Review for All ABL2 Products
Required fields are marked with *



