Recombinant Human ABL2 Protein, GST-Tagged

Cat.No. : ABL2-106H
Product Overview : Human ABL2 partial ORF ( AAH65912, 743 a.a. - 842 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinases. The protein is highly similar to the c-abl oncogene 1 protein, including the tyrosine kinase, SH2 and SH3 domains, and it plays a role in cytoskeletal rearrangements through its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ets variant 6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Nov 2009]
Molecular Mass : 36.41 kDa
AA Sequence : KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABL2 v-abl Abelson murine leukemia viral oncogene homolog 2 [ Homo sapiens ]
Official Symbol ABL2
Synonyms ABL2; v-abl Abelson murine leukemia viral oncogene homolog 2; ABLL, v abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson related gene); Abelson tyrosine-protein kinase 2; Abelson related gene; ARG; tyrosine-protein kinase ARG; abelson-related gene protein; ABLL;
Gene ID 27
mRNA Refseq NM_001136000
Protein Refseq NP_001129472
MIM 164690
UniProt ID P42684

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABL2 Products

Required fields are marked with *

My Review for All ABL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon