Recombinant Human ABP1 Protein, GST-Tagged
| Cat.No. : | ABP1-114H |
| Product Overview : | Human ABP1 partial ORF ( NP_001082, 501 a.a. - 599 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2013] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | LHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQMKLENITNPWSPRHRVVQPTLEQTQYSWERQAAFRFKRKLPKYLLFTSPQENPWGHKRSYRLQIHS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ABP1 amiloride binding protein 1 (amine oxidase (copper-containing)) [ Homo sapiens ] |
| Official Symbol | ABP1 |
| Synonyms | ABP1; amiloride binding protein 1 (amine oxidase (copper-containing)); amiloride-sensitive amine oxidase [copper-containing]; AOC1; DAO; histaminase; diamine oxidase; kidney amine oxidase; amiloride-binding protein-1; amiloride-sensitive amine oxidase; ABP; KAO; DAO1; |
| Gene ID | 26 |
| mRNA Refseq | NM_001091 |
| Protein Refseq | NP_001082 |
| MIM | 104610 |
| UniProt ID | P19801 |
| ◆ Recombinant Proteins | ||
| ABP1-834HF | Recombinant Full Length Human ABP1 Protein, GST-tagged | +Inquiry |
| ABP1-16H | Recombinant Human ABP1 Protein, His-tagged | +Inquiry |
| ABP1-113H | Recombinant Human ABP1 Protein, GST-Tagged | +Inquiry |
| ABP1-15H | Recombinant Human ABP1 Protein, His-tagged | +Inquiry |
| ABP1-114H | Recombinant Human ABP1 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABP1-9123HCL | Recombinant Human ABP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABP1 Products
Required fields are marked with *
My Review for All ABP1 Products
Required fields are marked with *
