Recombinant Human ABP1 Protein, GST-Tagged

Cat.No. : ABP1-114H
Product Overview : Human ABP1 partial ORF ( NP_001082, 501 a.a. - 599 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2013]
Molecular Mass : 36.63 kDa
AA Sequence : LHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQMKLENITNPWSPRHRVVQPTLEQTQYSWERQAAFRFKRKLPKYLLFTSPQENPWGHKRSYRLQIHS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABP1 amiloride binding protein 1 (amine oxidase (copper-containing)) [ Homo sapiens ]
Official Symbol ABP1
Synonyms ABP1; amiloride binding protein 1 (amine oxidase (copper-containing)); amiloride-sensitive amine oxidase [copper-containing]; AOC1; DAO; histaminase; diamine oxidase; kidney amine oxidase; amiloride-binding protein-1; amiloride-sensitive amine oxidase; ABP; KAO; DAO1;
Gene ID 26
mRNA Refseq NM_001091
Protein Refseq NP_001082
MIM 104610
UniProt ID P19801

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABP1 Products

Required fields are marked with *

My Review for All ABP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon