Recombinant Human ABR Protein, GST-Tagged

Cat.No. : ABR-116H
Product Overview : Human ABR partial ORF ( NP_068781, 750 a.a. - 859 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene. [provided by RefSeq, Feb 2012]
Molecular Mass : 37.84 kDa
AA Sequence : PAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABR active BCR-related [ Homo sapiens ]
Official Symbol ABR
Synonyms ABR; active BCR-related; active BCR related gene; active breakpoint cluster region-related protein; MDB; FLJ45954;
Gene ID 29
mRNA Refseq NM_001092
Protein Refseq NP_001083
MIM 600365
UniProt ID Q12979

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABR Products

Required fields are marked with *

My Review for All ABR Products

Required fields are marked with *

0
cart-icon
0
compare icon