Recombinant Human ABR protein, GST-tagged
Cat.No. : | ABR-301435H |
Product Overview : | Recombinant Human ABR (1-87 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Lys87 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ABR active BCR-related [ Homo sapiens ] |
Official Symbol | ABR |
Synonyms | ABR; active BCR-related; active BCR related gene; active breakpoint cluster region-related protein; MDB; FLJ45954; |
Gene ID | 29 |
mRNA Refseq | NM_001092 |
Protein Refseq | NP_001083 |
MIM | 600365 |
UniProt ID | Q12979 |
◆ Recombinant Proteins | ||
ABR-1148M | Recombinant Mouse ABR Protein | +Inquiry |
ABR-835HF | Recombinant Full Length Human ABR Protein, GST-tagged | +Inquiry |
ABR-3116B | Recombinant Bovine ABR, His-tagged | +Inquiry |
Abr-445M | Recombinant Mouse Abr Protein, MYC/DDK-tagged | +Inquiry |
ABR-226M | Recombinant Mouse ABR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABR-9122HCL | Recombinant Human ABR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABR Products
Required fields are marked with *
My Review for All ABR Products
Required fields are marked with *