Recombinant Human ABTB1 Protein, GST-Tagged

Cat.No. : ABTB1-121H
Product Overview : Human ABTB1 partial ORF ( NP_742024, 271 a.a. - 370 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein with an ankyrin repeat region and two BTB/POZ domains, which are thought to be involved in protein-protein interactions. Expression of this gene is activated by the phosphatase and tensin homolog, a tumor suppressor. Alternate splicing results in three transcript variants. [provided by RefSeq, Mar 2010]
Molecular Mass : 36.74 kDa
AA Sequence : CPDICFRVAGCSFLCHKAFFCGRSDYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYLLPGLKRLCGR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABTB1 ankyrin repeat and BTB (POZ) domain containing 1 [ Homo sapiens ]
Official Symbol ABTB1
Synonyms ABTB1; ankyrin repeat and BTB (POZ) domain containing 1; ankyrin repeat and BTB/POZ domain-containing protein 1; BPOZ; Btb3; EF1ABP; elongation factor 1A-binding protein; BTB3; PP2259; MGC20585;
Gene ID 80325
mRNA Refseq NM_032548
Protein Refseq NP_115937
MIM 608308
UniProt ID Q969K4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABTB1 Products

Required fields are marked with *

My Review for All ABTB1 Products

Required fields are marked with *

0
cart-icon