Recombinant Human ABTB1 Protein, GST-Tagged
| Cat.No. : | ABTB1-121H |
| Product Overview : | Human ABTB1 partial ORF ( NP_742024, 271 a.a. - 370 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein with an ankyrin repeat region and two BTB/POZ domains, which are thought to be involved in protein-protein interactions. Expression of this gene is activated by the phosphatase and tensin homolog, a tumor suppressor. Alternate splicing results in three transcript variants. [provided by RefSeq, Mar 2010] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | CPDICFRVAGCSFLCHKAFFCGRSDYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYLLPGLKRLCGR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ABTB1 ankyrin repeat and BTB (POZ) domain containing 1 [ Homo sapiens ] |
| Official Symbol | ABTB1 |
| Synonyms | ABTB1; ankyrin repeat and BTB (POZ) domain containing 1; ankyrin repeat and BTB/POZ domain-containing protein 1; BPOZ; Btb3; EF1ABP; elongation factor 1A-binding protein; BTB3; PP2259; MGC20585; |
| Gene ID | 80325 |
| mRNA Refseq | NM_032548 |
| Protein Refseq | NP_115937 |
| MIM | 608308 |
| UniProt ID | Q969K4 |
| ◆ Recombinant Proteins | ||
| ABTB1-120H | Recombinant Human ABTB1 Protein, GST-Tagged | +Inquiry |
| ABTB1-672H | Recombinant Human ABTB1 Protein, His-tagged | +Inquiry |
| ABTB1-430R | Recombinant Rat ABTB1 Protein | +Inquiry |
| ABTB1-229M | Recombinant Mouse ABTB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ABTB1-121H | Recombinant Human ABTB1 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABTB1-13HCL | Recombinant Human ABTB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABTB1 Products
Required fields are marked with *
My Review for All ABTB1 Products
Required fields are marked with *
