Recombinant Human ACAD8 Protein, GST-Tagged
| Cat.No. : | ACAD8-130H |
| Product Overview : | Human ACAD8 partial ORF ( NP_055199, 306 a.a. - 415 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency.[provided by RefSeq, Nov 2009] |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | GEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ACAD8 acyl-CoA dehydrogenase family, member 8 [ Homo sapiens ] |
| Official Symbol | ACAD8 |
| Synonyms | ACAD8; acyl-CoA dehydrogenase family, member 8; acyl Coenzyme A dehydrogenase family, member 8; isobutyryl-CoA dehydrogenase, mitochondrial; activator-recruited cofactor 42 kDa component; acyl-Coenzyme A dehydrogenase family, member 8; ARC42; ACAD-8; |
| Gene ID | 27034 |
| mRNA Refseq | NM_014384 |
| Protein Refseq | NP_055199 |
| MIM | 604773 |
| UniProt ID | Q9UKU7 |
| ◆ Recombinant Proteins | ||
| ACAD8-129H | Recombinant Human ACAD8 Protein, GST-Tagged | +Inquiry |
| ACAD8-26H | Recombinant Human ACAD8, T7-tagged | +Inquiry |
| ACAD8-130H | Recombinant Human ACAD8 Protein, GST-Tagged | +Inquiry |
| ACAD8-5336C | Recombinant Chicken ACAD8 | +Inquiry |
| Acad8-1485M | Recombinant Mouse Acad8 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACAD8-9116HCL | Recombinant Human ACAD8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACAD8 Products
Required fields are marked with *
My Review for All ACAD8 Products
Required fields are marked with *
