Recombinant Human ACAD8 Protein, GST-Tagged

Cat.No. : ACAD8-130H
Product Overview : Human ACAD8 partial ORF ( NP_055199, 306 a.a. - 415 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency.[provided by RefSeq, Nov 2009]
Molecular Mass : 37.84 kDa
AA Sequence : GEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACAD8 acyl-CoA dehydrogenase family, member 8 [ Homo sapiens ]
Official Symbol ACAD8
Synonyms ACAD8; acyl-CoA dehydrogenase family, member 8; acyl Coenzyme A dehydrogenase family, member 8; isobutyryl-CoA dehydrogenase, mitochondrial; activator-recruited cofactor 42 kDa component; acyl-Coenzyme A dehydrogenase family, member 8; ARC42; ACAD-8;
Gene ID 27034
mRNA Refseq NM_014384
Protein Refseq NP_055199
MIM 604773
UniProt ID Q9UKU7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACAD8 Products

Required fields are marked with *

My Review for All ACAD8 Products

Required fields are marked with *

0
cart-icon