Recombinant Human ACAD8 protein, T7-tagged
Cat.No. : | ACAD8-211H |
Product Overview : | Recombinant human ACAD8 (23-415aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 23-415 a.a. |
Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFGSLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRK AAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKF ASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGPGPKGISCIVVEKGTPGLSFG KKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQF GEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLK DYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | ACAD8 acyl-CoA dehydrogenase family, member 8 [ Homo sapiens ] |
Official Symbol | ACAD8 |
Synonyms | ACAD8; acyl-Coenzyme A dehydrogenase family, member 8; ARC42; ACAD-8; |
Gene ID | 27034 |
mRNA Refseq | NM_014384 |
Protein Refseq | NP_055199 |
MIM | 604773 |
UniProt ID | Q9UKU7 |
Chromosome Location | 11q25 |
Pathway | Branched-chain amino acid catabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Valine, leucine and isoleucine degradation, organism-specific biosystem; Valine, leucine and isoleucine degradation, conserved biosystem; valine degradation I, organism-specific biosystem; |
Function | acyl-CoA dehydrogenase activity; acyl-CoA dehydrogenase activity; flavin adenine dinucleotide binding; |
◆ Recombinant Proteins | ||
ACAD8-26H | Recombinant Human ACAD8, T7-tagged | +Inquiry |
ACAD8-211H | Recombinant Human ACAD8 protein, T7-tagged | +Inquiry |
ACAD8-5336C | Recombinant Chicken ACAD8 | +Inquiry |
ACAD8-11374Z | Recombinant Zebrafish ACAD8 | +Inquiry |
ACAD8-1160M | Recombinant Mouse ACAD8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACAD8-9116HCL | Recombinant Human ACAD8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACAD8 Products
Required fields are marked with *
My Review for All ACAD8 Products
Required fields are marked with *