"ACAD8" Related Products

Expand
Expand
Expand

Recombinant Human ACAD8 protein, T7-tagged

Cat.No.: ACAD8-211H
Product Overview: Recombinant human ACAD8 (23-415aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFGSLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRK AAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKF ASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGPGPKGISCIVVEKGTPGLSFG KKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQF GEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLK DYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: ACAD8 acyl-CoA dehydrogenase family, member 8 [ Homo sapiens ]
Official Symbol: ACAD8
Synonyms: ACAD8; acyl-Coenzyme A dehydrogenase family, member 8; ARC42; ACAD-8;
Gene ID: 27034
mRNA Refseq: NM_014384
Protein Refseq: NP_055199
MIM: 604773
UniProt ID: Q9UKU7
Chromosome Location: 11q25
Pathway: Branched-chain amino acid catabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Valine, leucine and isoleucine degradation, organism-specific biosystem; Valine, leucine and isoleucine degradation, conserved biosystem; valine degradation I, organism-specific biosystem;
Function: acyl-CoA dehydrogenase activity; acyl-CoA dehydrogenase activity; flavin adenine dinucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.