Recombinant Human ACAN Protein, GST-tagged
| Cat.No. : | ACAN-420H |
| Product Overview : | Human AGC1 partial ORF ( NP_037359, 56 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the aggrecan/versican proteoglycan family. The encoded protein is an integral part of the extracellular matrix in cartilagenous tissue and it withstands compression in cartilage. Mutations in this gene may be involved in skeletal dysplasia and spinal degeneration. Multiple alternatively spliced transcript variants that encode different protein isoforms have been observed in this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | PMHPVTTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ACAN aggrecan [ Homo sapiens ] |
| Official Symbol | ACAN |
| Synonyms | ACAN; aggrecan; AGC1, aggrecan 1, chondroitin sulfate proteoglycan 1, CSPG1, MSK16; aggrecan core protein; aggrecan proteoglycan; CSPGCP; large aggregating proteoglycan; cartilage-specific proteoglycan core protein; chondroitin sulfate proteoglycan core protein 1; AGC1; SEDK; AGCAN; CSPG1; MSK16; |
| Gene ID | 176 |
| mRNA Refseq | NM_001135 |
| Protein Refseq | NP_001126 |
| MIM | 155760 |
| UniProt ID | P16112 |
| ◆ Recombinant Proteins | ||
| ACAN-420H | Recombinant Human ACAN Protein, GST-tagged | +Inquiry |
| ACAN-4356H | Recombinant Human ACAN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ACAN-441R | Recombinant Rat ACAN Protein | +Inquiry |
| ACAN-6514C | Recombinant Chicken ACAN | +Inquiry |
| ACAN-102H | Active Recombinant Human ACAN, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACAN-35HCL | Recombinant Human ACAN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACAN Products
Required fields are marked with *
My Review for All ACAN Products
Required fields are marked with *
