Recombinant Human ACAP1 protein, His-tagged
| Cat.No. : | ACAP1-7343H |
| Product Overview : | Recombinant Human ACAP1 protein(163-270 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 163-270 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | RAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEG |
| Gene Name | ACAP1 ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 [ Homo sapiens ] |
| Official Symbol | ACAP1 |
| Synonyms | ACAP1; ArfGAP with coiled-coil, ankyrin repeat and PH domains 1; centaurin, beta 1 , CENTB1; arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1; KIAA0050; cnt-b1; centaurin-beta-1; centaurin, beta 1; Arf GAP with coiled coil, ANK repeat and PH domains 1; CENTB1; |
| Gene ID | 9744 |
| mRNA Refseq | NM_014716 |
| Protein Refseq | NP_055531 |
| MIM | 607763 |
| UniProt ID | Q15027 |
| ◆ Recombinant Proteins | ||
| ACAP1-2572HF | Recombinant Full Length Human ACAP1 Protein, GST-tagged | +Inquiry |
| AARS-0409H | Recombinant Human AARS protein, His-tagged | +Inquiry |
| EPHB4-0416H | Recombinant Human EPHB4 protein, His-tagged | +Inquiry |
| ACAP1-7342H | Recombinant Human ACAP1 protein, GST-tagged | +Inquiry |
| Acap1-1487M | Recombinant Mouse Acap1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACAP1-9110HCL | Recombinant Human ACAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACAP1 Products
Required fields are marked with *
My Review for All ACAP1 Products
Required fields are marked with *
