Recombinant Human ACMSD Protein, GST-Tagged

Cat.No. : ACMSD-160H
Product Overview : Human ACMSD full-length ORF ( AAH16018.1, 1 a.a. - 278 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-278 aa
Description : The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders. Quinolinate is derived from alpha-amino-beta-carboxy-muconate-epsilon-semialdehyde (ACMS). ACMSD (ACMS decarboxylase; EC 4.1.1.45) can divert ACMS to a benign catabolite and thus prevent the accumulation of quinolinate from ACMS.[supplied by OMIM, Oct 2004]
Molecular Mass : 57.6 kDa
AA Sequence : MGKSSEWCERIAGIQKFVLEKWTKKAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACMSD aminocarboxymuconate semialdehyde decarboxylase [ Homo sapiens ]
Official Symbol ACMSD
Synonyms ACMSD; aminocarboxymuconate semialdehyde decarboxylase; 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; picolinate carboxylase;
Gene ID 130013
mRNA Refseq NM_138326
Protein Refseq NP_612199
MIM 608889
UniProt ID Q8TDX5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACMSD Products

Required fields are marked with *

My Review for All ACMSD Products

Required fields are marked with *

0
cart-icon
0
compare icon