Recombinant Human ACMSD Protein, GST-Tagged
Cat.No. : | ACMSD-160H |
Product Overview : | Human ACMSD full-length ORF ( AAH16018.1, 1 a.a. - 278 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-278 aa |
Description : | The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders. Quinolinate is derived from alpha-amino-beta-carboxy-muconate-epsilon-semialdehyde (ACMS). ACMSD (ACMS decarboxylase; EC 4.1.1.45) can divert ACMS to a benign catabolite and thus prevent the accumulation of quinolinate from ACMS.[supplied by OMIM, Oct 2004] |
Molecular Mass : | 57.6 kDa |
AA Sequence : | MGKSSEWCERIAGIQKFVLEKWTKKAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACMSD aminocarboxymuconate semialdehyde decarboxylase [ Homo sapiens ] |
Official Symbol | ACMSD |
Synonyms | ACMSD; aminocarboxymuconate semialdehyde decarboxylase; 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; picolinate carboxylase; |
Gene ID | 130013 |
mRNA Refseq | NM_138326 |
Protein Refseq | NP_612199 |
MIM | 608889 |
UniProt ID | Q8TDX5 |
◆ Recombinant Proteins | ||
Acmsd-1497M | Recombinant Mouse Acmsd Protein, Myc/DDK-tagged | +Inquiry |
ACMSD-1720H | Recombinant Human ACMSD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACMSD-10H | Recombinant Human ACMSD Protein, His-tagged | +Inquiry |
ACMSD-5594Z | Recombinant Zebrafish ACMSD | +Inquiry |
ACMSD-451R | Recombinant Rat ACMSD Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACMSD-5HCL | Recombinant Human ACMSD lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACMSD Products
Required fields are marked with *
My Review for All ACMSD Products
Required fields are marked with *