Recombinant Human ACOT6, His-tagged
Cat.No. : | ACOT6-17H |
Product Overview : | Recombinant Human Putative Acyl-Coenzyme A Thioesterase 6/ACOT6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Ile207) of Human ACOT6 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-207 a.a. |
Description : | Putative Acyl-Coenzyme A Thioesterase 6 (ACOT60 is a member of the C/M/P thioester hydrolase family. It has been revealed by sequence analysis that ACOT6 consists of a putative peroxisomal targeting signal at the C-terminal end. Cellular localization experiments show that it serves as a peroxisomal enzyme. Otherwise, ACOT6 has been identified as a target gene of the peroxisome proliferator-activated receptor alpha (PPARα) and is up-regulated in mouse liver in a PPARα-dependent manner. |
AA Sequence : | MLQHPKVKGPSIALLGFSKGGDLCLSMASFLKGITATVLINACVANTVAPLHYKDMIIPK LVDD LGKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFY AQIASERL QAHGKERPQIICYPETGHCIDPPYFPPSRASVHAVLGEAIFYGGEPKAHSKA QVDAWQQIQTFF HKHLNGKKSVKHSKIVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
◆ Recombinant Proteins | ||
ACOT6-40R | Recombinant Rhesus Macaque ACOT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACOT6-17H | Recombinant Human ACOT6, His-tagged | +Inquiry |
ACOT6-786HF | Recombinant Full Length Human ACOT6 Protein, GST-tagged | +Inquiry |
ACOT6-169H | Recombinant Human ACOT6 Protein, GST-Tagged | +Inquiry |
ACOT6-212R | Recombinant Rhesus monkey ACOT6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACOT6-9088HCL | Recombinant Human ACOT6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACOT6 Products
Required fields are marked with *
My Review for All ACOT6 Products
Required fields are marked with *
0
Inquiry Basket