Recombinant Human ACOT6 Protein, GST-Tagged

Cat.No. : ACOT6-169H
Product Overview : Human ACOT6 full-length ORF ( ADR82840.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ACOT6 (Acyl-CoA Thioesterase 6) is a Protein Coding gene. Among its related pathways are Metabolism and Fatty Acyl-CoA Biosynthesis. GO annotations related to this gene include carboxylic ester hydrolase activity. An important paralog of this gene is ACOT2.
Molecular Mass : 22.8 kDa
AA Sequence : MLQHPKVKGPSIALLGFSKGGDLCLSMASFLKGITATVLINACVANTVAPLHYKDMIIPKLVDDLGKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQIASERLQAHGKERPQIICYPETGHCIDPPYFPPSRASVHAVLGEAIFYGGEPKAHSKAQVDAWQQIQTFFHKHLNGKKSVKHSKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACOT6 acyl-CoA thioesterase 6 [ Homo sapiens (human) ]
Official Symbol ACOT6
Synonyms ACOT6; acyl-CoA thioesterase 6; Acyl-CoA Thioesterase 6; Putative Acyl-CoA Thioesterase 6; C14orf42; Putative Acyl-Coenzyme A Thioesterase 6; Chromosome 14 Open Reading Frame 42; EC 3.1.2.2; EC 3.1.2.-; C14_5530; C14orf42; c14_5530; putative acyl-coenzyme A thioesterase 6; putative acyl-CoA thioesterase 6
Gene ID 641372
mRNA Refseq NM_001037162
Protein Refseq NP_001032239
MIM 614267
UniProt ID Q3I5F7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACOT6 Products

Required fields are marked with *

My Review for All ACOT6 Products

Required fields are marked with *

0
cart-icon
0
compare icon