Recombinant Human ACOT6 protein, His-tagged
Cat.No. : | ACOT6-9300H |
Product Overview : | Recombinant Human ACOT6 protein(37-126 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 37-126 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | TVLINACVANTVAPLHYKDMIIPKLVDDLGKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQIASE |
◆ Recombinant Proteins | ||
ACVR2B-0491H | Recombinant Human ACVR2B Protein (Ser19-Thr134), C-His-tagged | +Inquiry |
ACVR2B-533H | Active Recombinant Human ACVR2B, Fc-tagged, Biotinylated | +Inquiry |
ACVR2B-2182C | Active Recombinant Cynomolgus ACVR2B protein, hFc-tagged | +Inquiry |
ACVR2B-257H | Active Recombinant Human ACVR2B Protein, GST-tagged | +Inquiry |
ACVR2B-197H | Recombinant Human ACVR2B protein(Met1-Thr134), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR2B-2540MCL | Recombinant Mouse ACVR2B cell lysate | +Inquiry |
ACVR2B-734CCL | Recombinant Cynomolgus ACVR2B cell lysate | +Inquiry |
ACVR2B-2724HCL | Recombinant Human ACVR2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACVR2B Products
Required fields are marked with *
My Review for All ACVR2B Products
Required fields are marked with *
0
Inquiry Basket