Recombinant Human ACOT9 Protein, GST-Tagged

Cat.No. : ACOT9-145H
Product Overview : Human ACATE2 full-length ORF ( AAH12573, 1 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a mitochondrial acyl-CoA thioesterase of unknown function. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]
Molecular Mass : 49.06 kDa
AA Sequence : MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACOT9 acyl-CoA thioesterase 9 [ Homo sapiens ]
Official Symbol ACOT9
Synonyms ACOT9; acyl-CoA thioesterase 9; acyl-coenzyme A thioesterase 9, mitochondrial; ACATE2; CGI 16; MT ACT48; acyl-CoA thioester hydrolase 9; mitochondrial Acyl-CoA Thioesterase; acyl-Coenzyme A thioesterase 2, mitochondrial; CGI-16; MTACT48; MT-ACT48;
Gene ID 23597
mRNA Refseq NM_001033583
Protein Refseq NP_001028755
MIM 300862
UniProt ID Q9Y305

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACOT9 Products

Required fields are marked with *

My Review for All ACOT9 Products

Required fields are marked with *

0
cart-icon