Recombinant Human ACSL3 protein, His-tagged
Cat.No. : | ACSL3-3788H |
Product Overview : | Recombinant Human ACSL3 protein(602-675 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 602-675 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | KNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFE |
Gene Name | ACSL3 acyl-CoA synthetase long-chain family member 3 [ Homo sapiens ] |
Official Symbol | ACSL3 |
Synonyms | ACSL3; acyl-CoA synthetase long-chain family member 3; FACL3, fatty acid Coenzyme A ligase, long chain 3; long-chain-fatty-acid--CoA ligase 3; ACS3; PRO2194; LACS 3; lignoceroyl-CoA synthase; long-chain acyl-CoA synthetase 3; fatty-acid-Coenzyme A ligase, long-chain 3; FACL3; |
Gene ID | 2181 |
mRNA Refseq | NM_004457 |
Protein Refseq | NP_004448 |
MIM | 602371 |
UniProt ID | O95573 |
◆ Recombinant Proteins | ||
ACSL3-3787H | Recombinant Human ACSL3 protein, His-tagged | +Inquiry |
ACSL3-3788H | Recombinant Human ACSL3 protein, His-tagged | +Inquiry |
ACSL3-796H | Recombinant Human ACSL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACSL3-196H | Recombinant Human ACSL3 Protein, GST-tagged | +Inquiry |
ACSL3-261H | Recombinant Human ACSL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSL3-9076HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
ACSL3-9077HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSL3 Products
Required fields are marked with *
My Review for All ACSL3 Products
Required fields are marked with *