Recombinant Human ACSM3 Protein, GST-tagged
Cat.No. : | ACSM3-206H |
Product Overview : | Human ACSM3 partial ORF ( NP_973729.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ACSM3 (Acyl-CoA Synthetase Medium-Chain Family Member 3) is a Protein Coding gene. Diseases associated with ACSM3 include Hypertension, Essential. Among its related pathways are Mitochondrial Fatty Acid Beta-Oxidation and Metabolism. GO annotations related to this gene include butyrate-CoA ligase activity and fatty acid ligase activity. An important paralog of this gene is ACSM4. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACSM3 acyl-CoA synthetase medium-chain family member 3 [ Homo sapiens ] |
Official Symbol | ACSM3 |
Synonyms | ACSM3; acyl-CoA synthetase medium-chain family member 3; SA (rat hypertension associated) homolog , SA hypertension associated homolog (rat) , SAH; acyl-coenzyme A synthetase ACSM3, mitochondrial; SA; protein SA homolog; butyrate--CoA ligase 3; butyryl-coenzyme A synthetase 3; SA hypertension-associated homolog; middle-chain acyl-CoA synthetase 3; SA (rat hypertension-associated) homolog; SAH; |
Gene ID | 6296 |
mRNA Refseq | NM_005622 |
Protein Refseq | NP_005613 |
MIM | 145505 |
UniProt ID | Q53FZ2 |
◆ Recombinant Proteins | ||
ACSM3-1232M | Recombinant Mouse ACSM3 Protein | +Inquiry |
ACSM3-474R | Recombinant Rat ACSM3 Protein | +Inquiry |
Acsm3-63M | Recombinant Mouse Acsm3 Protein, His-tagged | +Inquiry |
ACSM3-206H | Recombinant Human ACSM3 Protein, GST-tagged | +Inquiry |
Acsm3-64R | Recombinant Rat Acsm3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSM3-9070HCL | Recombinant Human ACSM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSM3 Products
Required fields are marked with *
My Review for All ACSM3 Products
Required fields are marked with *