Recombinant Human ACSM3 Protein, GST-tagged

Cat.No. : ACSM3-206H
Product Overview : Human ACSM3 partial ORF ( NP_973729.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ACSM3 (Acyl-CoA Synthetase Medium-Chain Family Member 3) is a Protein Coding gene. Diseases associated with ACSM3 include Hypertension, Essential. Among its related pathways are Mitochondrial Fatty Acid Beta-Oxidation and Metabolism. GO annotations related to this gene include butyrate-CoA ligase activity and fatty acid ligase activity. An important paralog of this gene is ACSM4.
Molecular Mass : 36.63 kDa
AA Sequence : MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACSM3 acyl-CoA synthetase medium-chain family member 3 [ Homo sapiens ]
Official Symbol ACSM3
Synonyms ACSM3; acyl-CoA synthetase medium-chain family member 3; SA (rat hypertension associated) homolog , SA hypertension associated homolog (rat) , SAH; acyl-coenzyme A synthetase ACSM3, mitochondrial; SA; protein SA homolog; butyrate--CoA ligase 3; butyryl-coenzyme A synthetase 3; SA hypertension-associated homolog; middle-chain acyl-CoA synthetase 3; SA (rat hypertension-associated) homolog; SAH;
Gene ID 6296
mRNA Refseq NM_005622
Protein Refseq NP_005613
MIM 145505
UniProt ID Q53FZ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACSM3 Products

Required fields are marked with *

My Review for All ACSM3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon