Recombinant Human ACSS3 protein, His-tagged
Cat.No. : | ACSS3-9329H |
Product Overview : | Recombinant Human ACSS3 protein(341-686 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 341-686 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | DLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA |
Gene Name | ACSS3 acyl-CoA synthetase short-chain family member 3 [ Homo sapiens ] |
Official Symbol | ACSS3 |
Synonyms | ACSS3; acyl-CoA synthetase short-chain family member 3; acyl-CoA synthetase short-chain family member 3, mitochondrial; FLJ21963; AMP-binding enzyme, 33217; |
Gene ID | 79611 |
mRNA Refseq | NM_024560 |
Protein Refseq | NP_078836 |
MIM | 614356 |
UniProt ID | Q9H6R3 |
◆ Recombinant Proteins | ||
AGO2-2180H | Recombinant Human AGO2, His-tagged | +Inquiry |
EIF2C2-2180H | Active Recombinant Human EIF2C2, His-tagged | +Inquiry |
AGO2-3693H | Recombinant Human AGO2 protein, GST-tagged | +Inquiry |
ACSS3-9329H | Recombinant Human ACSS3 protein, His-tagged | +Inquiry |
AGO2-1728H | Recombinant Human AGO2 Protein (517-818 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGO2-714HCL | Recombinant Human AGO2 cell lysate | +Inquiry |
AGO2-576MCL | Recombinant Mouse AGO2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGO2 Products
Required fields are marked with *
My Review for All AGO2 Products
Required fields are marked with *
0
Inquiry Basket