Recombinant Human ACSS3 protein, His-tagged
| Cat.No. : | ACSS3-9329H |
| Product Overview : | Recombinant Human ACSS3 protein(341-686 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | December 22, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 341-686 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | DLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA |
| Gene Name | ACSS3 acyl-CoA synthetase short-chain family member 3 [ Homo sapiens ] |
| Official Symbol | ACSS3 |
| Synonyms | ACSS3; acyl-CoA synthetase short-chain family member 3; acyl-CoA synthetase short-chain family member 3, mitochondrial; FLJ21963; AMP-binding enzyme, 33217; |
| Gene ID | 79611 |
| mRNA Refseq | NM_024560 |
| Protein Refseq | NP_078836 |
| MIM | 614356 |
| UniProt ID | Q9H6R3 |
| ◆ Recombinant Proteins | ||
| ACSS3-2060H | Recombinant Human ACSS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ACSS3-18H | Recombinant Human ACSS3, His-tagged | +Inquiry |
| ACSS3-9329H | Recombinant Human ACSS3 protein, His-tagged | +Inquiry |
| ACSS3-280M | Recombinant Mouse ACSS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ACSS3-265H | Recombinant Human ACSS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACSS3-9067HCL | Recombinant Human ACSS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSS3 Products
Required fields are marked with *
My Review for All ACSS3 Products
Required fields are marked with *
