Recombinant Human Activin A Receptor, Type I

• Cat.No.: ACVR1-01H
• Product Overview: Recombinant Human Activin A Receptor, Type I was expressed in sf9.

Specification

• Species: Human
• Source: Sf9 Cells
• Tag: Non
• Description: Human Activin A is a 26.0 kDa disulfide-linked homodimer of two βA chains, each containing 116 amino acid residues, belonging to the TGF-β family. It exhibits a wide range of biological activity including regulation of cellular proliferation and differentiation, and promotion of neuronal survival. Elevated levels of Activin A in human colorectal tumors and in postmenopausal women have been implicated in colorectal and breast cancers, respectively. The biological activities of Activin A can be neutralized by inhibins and by the diffusible TGF-β antagonist, follistatin.
• Form: Liquid
• Molecular Mass: The secreted recombinant human ALK2 consists of 123 amino acids and has a calculated molecular mass of 13.5KDa. It migrates as an approximately 17kDa band in SDS-PAGE under reducing conditions.
• AA Sequence: MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYE QGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE
• Purity: >93% as determined by SDS-PAGE.
• Storage: Store it at +4°C for short term. For long term storage, store it at -20°C ~ -70°C.
• Storage Buffer: 25 mM Tris-HCl, pH7.4, 300 mM NaCl ,1 mM DTT, 5% Trehalose.
• Publications:
  An anti-ACVR1 antibody exacerbates heterotopic ossification by fibro-adipogenic progenitors in fibrodysplasia ossificans progressiva mice (2022)

Gene Information

• Gene Name: ACVR1 activin A receptor, type I [ Homo sapiens ]
• Official Symbol: ACVR1
• Synonyms: ACVR1; activin A receptor, type I; ACVRLK2; activin receptor type-1; ACVR1A; ALK2; SKR1; activin receptor type I; hydroxyalkyl-protein kinase; activin receptor-like kinase 2; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 2; serine/threonine-protein kinase receptor R1; FOP; TSRI; ACTRI
• Gene ID: 90
• mRNA Refseq: NM_001105
• Protein Refseq: NP_001096
• MIM: 102576
• UniProt ID: Q04771
• Chromosome Location: 2q23-q24
• Pathway: ALK1 pathway, organism-specific biosystem; ALK1 signaling events, organism-specific biosystem; ALK2 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem
• Function: ATP binding; SMAD binding; activin binding; contributes_to activin receptor activity, type I; follistatin binding; metal ion binding; nucleotide binding; protein binding; protein homodimerization activity; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I; transmembrane receptor protein serine/threonine kinase activity