Recombinant Human Activin A Receptor, Type I
Cat.No. : | ACVR1-01H |
Product Overview : | Recombinant Human Activin A Receptor, Type I was expressed in sf9. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Sf9 Cells |
Tag : | Non |
Description : | Human Activin A is a 26.0 kDa disulfide-linked homodimer of two βA chains, each containing 116 amino acid residues, belonging to the TGF-β family. It exhibits a wide range of biological activity including regulation of cellular proliferation and differentiation, and promotion of neuronal survival. Elevated levels of Activin A in human colorectal tumors and in postmenopausal women have been implicated in colorectal and breast cancers, respectively. The biological activities of Activin A can be neutralized by inhibins and by the diffusible TGF-β antagonist, follistatin. |
Form : | Liquid |
Molecular Mass : | The secreted recombinant human ALK2 consists of 123 amino acids and has a calculated molecular mass of 13.5KDa. It migrates as an approximately 17kDa band in SDS-PAGE under reducing conditions. |
AA Sequence : | MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYE QGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE |
Purity : | >93% as determined by SDS-PAGE. |
Storage : | Store it at +4°C for short term. For long term storage, store it at -20°C ~ -70°C. |
Storage Buffer : | 25 mM Tris-HCl, pH7.4, 300 mM NaCl ,1 mM DTT, 5% Trehalose. |
Publications : |
An anti-ACVR1 antibody exacerbates heterotopic ossification by fibro-adipogenic progenitors in fibrodysplasia ossificans progressiva mice (2022)
|
Gene Name | ACVR1 activin A receptor, type I [ Homo sapiens ] |
Official Symbol | ACVR1 |
Synonyms | ACVR1; activin A receptor, type I; ACVRLK2; activin receptor type-1; ACVR1A; ALK2; SKR1; activin receptor type I; hydroxyalkyl-protein kinase; activin receptor-like kinase 2; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 2; serine/threonine-protein kinase receptor R1; FOP; TSRI; ACTRI; |
Gene ID | 90 |
mRNA Refseq | NM_001105 |
Protein Refseq | NP_001096 |
MIM | 102576 |
UniProt ID | Q04771 |
Chromosome Location | 2q23-q24 |
Pathway | ALK1 pathway, organism-specific biosystem; ALK1 signaling events, organism-specific biosystem; ALK2 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; |
Function | ATP binding; SMAD binding; activin binding; contributes_to activin receptor activity, type I; follistatin binding; metal ion binding; nucleotide binding; protein binding; protein homodimerization activity; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I; transmembrane receptor protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
Acvr1-814M | Recombinant Mouse Acvr1 Protein, MYC/DDK-tagged | +Inquiry |
ACVR1-01H | Recombinant Human Activin A Receptor, Type I | +Inquiry |
ACVR1-8141H | Recombinant Human ACVR1 protein, His-tagged | +Inquiry |
ACVR1-199H | Active Recombinant Human ACVR1 Protein, His-tagged | +Inquiry |
ACVR1-201H | Active Recombinant Human ACVR1(R206H), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR1-1232CCL | Recombinant Cynomolgus ACVR1 cell lysate | +Inquiry |
ACVR1-2686MCL | Recombinant Mouse ACVR1 cell lysate | +Inquiry |
ACVR1-3097HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
ACVR1-1305RCL | Recombinant Rat ACVR1 cell lysate | +Inquiry |
ACVR1-478HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACVR1 Products
Required fields are marked with *
My Review for All ACVR1 Products
Required fields are marked with *
0
Inquiry Basket