Recombinant Human ACTL6B protein, His-Flag-tagged
| Cat.No. : | ACTL6B-5324H |
| Product Overview : | Recombinant Human ACTL6B protein(O94805)(1-426aa), fused with C-terminal His-Flag tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Flag&His |
| Protein Length : | 1-426aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.8 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP |
| Gene Name | ACTL6B actin-like 6B [ Homo sapiens ] |
| Official Symbol | ACTL6B |
| Synonyms | ACTL6B; actin-like 6B; actin like 6 , ACTL6; actin-like protein 6B; BAF53B; arpNalpha; hArpN alpha; actin-like 6; BRG1-associated factor 53B; actin-related protein Baf53b; 53 kDa BRG1-associated factor B; ACTL6; |
| Gene ID | 51412 |
| mRNA Refseq | NM_016188 |
| Protein Refseq | NP_057272 |
| MIM | 612458 |
| UniProt ID | O94805 |
| ◆ Recombinant Proteins | ||
| ACTL6B-846HF | Recombinant Full Length Human ACTL6B Protein, GST-tagged | +Inquiry |
| ACTL6B-26300TH | Recombinant Human ACTL6B, His-tagged | +Inquiry |
| ACTL6B-482R | Recombinant Rat ACTL6B Protein | +Inquiry |
| ACTL6B-5324H | Recombinant Human ACTL6B protein, His-Flag-tagged | +Inquiry |
| ACTL6B-223R | Recombinant Rhesus monkey ACTL6B Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACTL6B-9060HCL | Recombinant Human ACTL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTL6B Products
Required fields are marked with *
My Review for All ACTL6B Products
Required fields are marked with *



