Recombinant Human ACTL7A protein, His-tagged
| Cat.No. : | ACTL7A-9336H |
| Product Overview : | Recombinant Human ACTL7A protein(1-280 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | January 31, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-280 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLGLLNSAGNEFTQDQMGIVEDIKKKCC |
| Gene Name | ACTL7A actin-like 7A [ Homo sapiens ] |
| Official Symbol | ACTL7A |
| Synonyms | ACTL7A; actin-like 7A; actin-like protein 7A; actin-like 7-alpha; actin-like-7-alpha; |
| Gene ID | 10881 |
| mRNA Refseq | NM_006687 |
| Protein Refseq | NP_006678 |
| MIM | 604303 |
| UniProt ID | Q9Y615 |
| ◆ Recombinant Proteins | ||
| ACTL7A-224H | Recombinant Human ACTL7A Protein, GST-tagged | +Inquiry |
| ACTL7A-483R | Recombinant Rat ACTL7A Protein | +Inquiry |
| ACTL7A-1169H | Recombinant Human ACTL7A Protein (1-435 aa), His-SUMO-tagged | +Inquiry |
| ACTL7A-9336H | Recombinant Human ACTL7A protein, His-tagged | +Inquiry |
| ACTL7A-26590TH | Recombinant Human ACTL7A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACTL7A-9059HCL | Recombinant Human ACTL7A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTL7A Products
Required fields are marked with *
My Review for All ACTL7A Products
Required fields are marked with *
