Recombinant Human ACTL7A protein, His-tagged
Cat.No. : | ACTL7A-9336H |
Product Overview : | Recombinant Human ACTL7A protein(1-280 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-280 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLGLLNSAGNEFTQDQMGIVEDIKKKCC |
Gene Name | ACTL7A actin-like 7A [ Homo sapiens ] |
Official Symbol | ACTL7A |
Synonyms | ACTL7A; actin-like 7A; actin-like protein 7A; actin-like 7-alpha; actin-like-7-alpha; |
Gene ID | 10881 |
mRNA Refseq | NM_006687 |
Protein Refseq | NP_006678 |
MIM | 604303 |
UniProt ID | Q9Y615 |
◆ Recombinant Proteins | ||
BCL2-26613TH | Recombinant Human BCL2, His-tagged | +Inquiry |
BCL2-438H | Recombinant Human BCL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BCL2-5361H | Recombinant Human B-cell CLL/lymphoma 2, His-tagged | +Inquiry |
Bcl2-1213R | Recombinant Rat Bcl2 Full Length Transmembrane protein, His-tagged | +Inquiry |
BCL2-267H | Active Recombinant Human BCL2 protein (Met 1-Asp 211), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL2 Products
Required fields are marked with *
My Review for All BCL2 Products
Required fields are marked with *
0
Inquiry Basket