Recombinant Human ACTL8 Protein (1-366 aa), His-tagged
| Cat.No. : | ACTL8-2660H |
| Product Overview : | Recombinant Human ACTL8 Protein (1-366 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-366 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 43.9 kDa |
| AA Sequence : | MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | ACTL8 actin-like 8 [ Homo sapiens ] |
| Official Symbol | ACTL8 |
| Synonyms | ACTL8; actin-like 8; actin-like protein 8; cancer/testis antigen 57; CT57; actin like protein; |
| Gene ID | 81569 |
| mRNA Refseq | NM_030812 |
| Protein Refseq | NP_110439 |
| UniProt ID | Q9H568 |
| ◆ Recombinant Proteins | ||
| ACTL8-2660H | Recombinant Human ACTL8 Protein (1-366 aa), His-tagged | +Inquiry |
| ACTL8-227H | Recombinant Human ACTL8 Protein, GST-tagged | +Inquiry |
| ACTL8-2777H | Recombinant Human ACTL8 Protein (1-366 aa), His-Myc-tagged | +Inquiry |
| ACTL8-4920H | Recombinant Human ACTL8 protein, His&Myc-tagged | +Inquiry |
| ACTL8-850HF | Recombinant Full Length Human ACTL8 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACTL8-9057HCL | Recombinant Human ACTL8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTL8 Products
Required fields are marked with *
My Review for All ACTL8 Products
Required fields are marked with *




