Recombinant Human ACTL8 Protein (1-366 aa), His-tagged

• Cat.No.: ACTL8-2660H
• Product Overview: Recombinant Human ACTL8 Protein (1-366 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-366 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 43.9 kDa
• AA Sequence: MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: ACTL8 actin-like 8 [ Homo sapiens ]
• Official Symbol: ACTL8
• Synonyms: ACTL8; actin-like 8; actin-like protein 8; cancer/testis antigen 57; CT57; actin like protein
• Gene ID: 81569
• mRNA Refseq: NM_030812
• Protein Refseq: NP_110439
• UniProt ID: Q9H568