Recombinant Human ACTL8 Protein (1-366 aa), His-tagged
Cat.No. : | ACTL8-2660H |
Product Overview : | Recombinant Human ACTL8 Protein (1-366 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-366 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 43.9 kDa |
AA Sequence : | MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | ACTL8 actin-like 8 [ Homo sapiens ] |
Official Symbol | ACTL8 |
Synonyms | ACTL8; actin-like 8; actin-like protein 8; cancer/testis antigen 57; CT57; actin like protein; |
Gene ID | 81569 |
mRNA Refseq | NM_030812 |
Protein Refseq | NP_110439 |
UniProt ID | Q9H568 |
◆ Recombinant Proteins | ||
ACTL8-4920H | Recombinant Human ACTL8 protein, His&Myc-tagged | +Inquiry |
ACTL8-227H | Recombinant Human ACTL8 Protein, GST-tagged | +Inquiry |
ACTL8-2777H | Recombinant Human ACTL8 Protein (1-366 aa), His-Myc-tagged | +Inquiry |
ACTL8-850HF | Recombinant Full Length Human ACTL8 Protein, GST-tagged | +Inquiry |
ACTL8-9338H | Recombinant Human ACTL8, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTL8-9057HCL | Recombinant Human ACTL8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTL8 Products
Required fields are marked with *
My Review for All ACTL8 Products
Required fields are marked with *
0
Inquiry Basket