Recombinant Human ACVR1 protein, His-tagged
Cat.No. : | ACVR1-8141H |
Product Overview : | Recombinant Human ACVR1 protein(), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE |
Gene Name | ACVR1 activin A receptor, type I [ Homo sapiens ] |
Official Symbol | ACVR1 |
Synonyms | ACVR1; activin A receptor, type I; ACVRLK2; activin receptor type-1; ACVR1A; ALK2; SKR1; activin receptor type I; hydroxyalkyl-protein kinase; activin receptor-like kinase 2; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 2; serine/threonine-protein kinase receptor R1; FOP; TSRI; ACTRI; |
Gene ID | 90 |
mRNA Refseq | NM_001105 |
Protein Refseq | NP_001096 |
MIM | 102576 |
UniProt ID | Q04771 |
◆ Recombinant Proteins | ||
ACVR1-1583H | Recombinant Human Activin A Receptor, Type I | +Inquiry |
ACVR1-245H | Active Recombinant Human ACVR1 Protein, GST-His-tagged | +Inquiry |
Acvr1-775M | Active Recombinant Mouse Acvr1 protein(Met1-Glu123), His&hFc-tagged | +Inquiry |
ACVR1-300C | Recombinant Canine ACVR1, His tagged | +Inquiry |
ACVR1-246H | Active Recombinant Human ACVR1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR1-1305RCL | Recombinant Rat ACVR1 cell lysate | +Inquiry |
ACVR1-3097HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
ACVR1-2686MCL | Recombinant Mouse ACVR1 cell lysate | +Inquiry |
ACVR1-1232CCL | Recombinant Cynomolgus ACVR1 cell lysate | +Inquiry |
ACVR1-478HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACVR1 Products
Required fields are marked with *
My Review for All ACVR1 Products
Required fields are marked with *