Recombinant Human ACVR2B protein, His-B2M-tagged
Cat.No. : | ACVR2B-4440H |
Product Overview : | Recombinant Human ACVR2B protein(Q13705)(19-137aa), fused to N-terminal His-B2M tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 19-137aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.7 |
AA Sequence : | SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ACVR2B activin A receptor, type IIB [ Homo sapiens ] |
Official Symbol | ACVR2B |
Synonyms | ACVR2B; activin A receptor, type IIB; activin receptor type-2B; ActR IIB; HTX4; ACTRIIB; ActR-IIB; |
Gene ID | 93 |
mRNA Refseq | NM_001106 |
Protein Refseq | NP_001097 |
MIM | 602730 |
UniProt ID | Q13705 |
◆ Recombinant Proteins | ||
ACVR2B-3284H | Recombinant Human ACVR2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Acvr2b-296R | Recombinant Rat Acvr2b Protein, His-tagged | +Inquiry |
ACVR2B-499H | Recombinant Human ACVR2B protein, HIgG1/His-tagged | +Inquiry |
ACVR2B-833HF | Recombinant Full Length Human ACVR2B Protein, GST-tagged | +Inquiry |
ACVR2B-2675H | Active Recombinant Human ACVR2B protein, hFc&His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR2B-2724HCL | Recombinant Human ACVR2B cell lysate | +Inquiry |
ACVR2B-734CCL | Recombinant Cynomolgus ACVR2B cell lysate | +Inquiry |
ACVR2B-2540MCL | Recombinant Mouse ACVR2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACVR2B Products
Required fields are marked with *
My Review for All ACVR2B Products
Required fields are marked with *