Recombinant Human ACY1, His-tagged
Cat.No. : | ACY1-26570TH |
Product Overview : | Recombinant full length Human Aminoacylase 1 with an N terminal His tag; 428 amino acids including tag, predicted MWt 48kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 408 amino acids |
Description : | This gene encodes a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and an acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. This gene is located on chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and this enzyme is the first member of a new family of zinc-binding enzymes. Mutations in this gene cause aminoacylase-1 deficiency, a metabolic disorder characterized by central nervous system defects and increased urinary excretion of N-acetylated amino acids. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ABHD14A (abhydrolase domain containing 14A) gene, as represented in GeneID:100526760. A related pseudogene has been identified on chromosome 18. |
Conjugation : | HIS |
Molecular Weight : | 48.000kDa inclusive of tags |
Tissue specificity : | Expression is highest in kidney, strong in brain and weaker in placenta and spleen. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS |
Sequence Similarities : | Belongs to the peptidase M20A family. |
Gene ID | ACY1 aminoacylase 1 [ Homo sapiens ] |
Official Symbol | ACY1 |
Synonyms | ACY1; aminoacylase 1; aminoacylase-1; |
◆ Recombinant Proteins | ||
Acy1-7144M | Recombinant Mouse Acy1 Protein, His-tagged | +Inquiry |
ACY1-27H | Recombinant Human Aminoacylase 1, T7-tagged | +Inquiry |
ACY1-153R | Recombinant Rat ACY1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Acy1-758M | Active Recombinant Mouse Acy1 protein(Met1-Ser408), His-tagged | +Inquiry |
ACY1-165H | Recombinant Human ACY1 protein, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACY1-3095MCL | Recombinant Mouse ACY1 cell lysate | +Inquiry |
ACY1-725HCL | Recombinant Human ACY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACY1 Products
Required fields are marked with *
My Review for All ACY1 Products
Required fields are marked with *
0
Inquiry Basket