Recombinant Human ADAL Protein, GST-tagged

Cat.No. : ADAL-271H
Product Overview : Human ADAL full-length ORF ( NP_001012987.1, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ADAL (Adenosine Deaminase Like) is a Protein Coding gene. Among its related pathways are Metabolism and Abacavir transport and metabolism. GO annotations related to this gene include adenosine deaminase activity and deaminase activity.
Molecular Mass : 56.4 kDa
AA Sequence : MIEAEEQQPCKTDFYSELPKVELHAHLNGSISSHTMKKLIAQKPDLKIHDQMTVIDKGKKRTLEECFQMFQTIHQLTSSPEDILMVTKDVIKEFADDGVKYLELRSTPRRENATGMTKKTYVESILEGIKQSKQENLDIDVRYLIAVDRRGGPLVAKETVKLAEEFFLSTEGTVLGLDLSGDPTVGQAKDFLEPLLEAKKAGLKLALHLSEIPNQKKETQILLDLLPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLGKAWSFRSSR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADAL adenosine deaminase-like [ Homo sapiens ]
Official Symbol ADAL
Synonyms ADAL; adenosine deaminase-like; adenosine deaminase-like protein; FLJ44620; DKFZp313B2137;
Gene ID 161823
mRNA Refseq NM_001012969
Protein Refseq NP_001012987
UniProt ID Q6DHV7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAL Products

Required fields are marked with *

My Review for All ADAL Products

Required fields are marked with *

0
cart-icon
0
compare icon