Recombinant Human ADAL Protein, GST-tagged
| Cat.No. : | ADAL-271H |
| Product Overview : | Human ADAL full-length ORF ( NP_001012987.1, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ADAL (Adenosine Deaminase Like) is a Protein Coding gene. Among its related pathways are Metabolism and Abacavir transport and metabolism. GO annotations related to this gene include adenosine deaminase activity and deaminase activity. |
| Molecular Mass : | 56.4 kDa |
| AA Sequence : | MIEAEEQQPCKTDFYSELPKVELHAHLNGSISSHTMKKLIAQKPDLKIHDQMTVIDKGKKRTLEECFQMFQTIHQLTSSPEDILMVTKDVIKEFADDGVKYLELRSTPRRENATGMTKKTYVESILEGIKQSKQENLDIDVRYLIAVDRRGGPLVAKETVKLAEEFFLSTEGTVLGLDLSGDPTVGQAKDFLEPLLEAKKAGLKLALHLSEIPNQKKETQILLDLLPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLGKAWSFRSSR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADAL adenosine deaminase-like [ Homo sapiens ] |
| Official Symbol | ADAL |
| Synonyms | ADAL; adenosine deaminase-like; adenosine deaminase-like protein; FLJ44620; DKFZp313B2137; |
| Gene ID | 161823 |
| mRNA Refseq | NM_001012969 |
| Protein Refseq | NP_001012987 |
| UniProt ID | Q6DHV7 |
| ◆ Recombinant Proteins | ||
| ADAL-1274M | Recombinant Mouse ADAL Protein | +Inquiry |
| ADAL-2261C | Recombinant Chicken ADAL | +Inquiry |
| ADAL-843HF | Recombinant Full Length Human ADAL Protein, GST-tagged | +Inquiry |
| ADAL-3419Z | Recombinant Zebrafish ADAL | +Inquiry |
| ADAL-271H | Recombinant Human ADAL Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADAL-9039HCL | Recombinant Human ADAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAL Products
Required fields are marked with *
My Review for All ADAL Products
Required fields are marked with *
