Recombinant Human ADAM10 protein, GST-tagged
| Cat.No. : | ADAM10-2422H |
| Product Overview : | Recombinant Human ADAM10 protein(306-512 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 306-512 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | EQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGKQCSTVCIQVKV |
| Gene Name | ADAM10 ADAM metallopeptidase domain 10 [ Homo sapiens ] |
| Official Symbol | ADAM10 |
| Synonyms | ADAM10; ADAM metallopeptidase domain 10; a disintegrin and metalloproteinase domain 10; disintegrin and metalloproteinase domain-containing protein 10; CD156c; HsT18717; kuz; MADM; CDw156; ADAM 10; kuzbanian protein homolog; mammalian disintegrin-metalloprotease; a disintegrin and metalloprotease domain 10; AD10; |
| Gene ID | 102 |
| mRNA Refseq | NM_001110 |
| Protein Refseq | NP_001101 |
| MIM | 602192 |
| UniProt ID | O14672 |
| ◆ Recombinant Proteins | ||
| ADAM10-7638H | Recombinant Human ADAM10 protein, His-tagged | +Inquiry |
| RFL-28202HF | Recombinant Full Length Human Disintegrin And Metalloproteinase Domain-Containing Protein 10(Adam10) Protein, His-Tagged | +Inquiry |
| ADAM10-73H | Recombinant Human ADAM10 Protein, His-tagged | +Inquiry |
| ADAM10-0691H | Recombinant Human ADAM10 Protein (Thr214-Ser504), N-His tagged | +Inquiry |
| Adam10-7639R | Recombinant Rat Adam10 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM10 Products
Required fields are marked with *
My Review for All ADAM10 Products
Required fields are marked with *



