Recombinant Human ADAM10 protein, GST-tagged
Cat.No. : | ADAM10-2422H |
Product Overview : | Recombinant Human ADAM10 protein(306-512 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 306-512 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | EQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGKQCSTVCIQVKV |
Gene Name | ADAM10 ADAM metallopeptidase domain 10 [ Homo sapiens ] |
Official Symbol | ADAM10 |
Synonyms | ADAM10; ADAM metallopeptidase domain 10; a disintegrin and metalloproteinase domain 10; disintegrin and metalloproteinase domain-containing protein 10; CD156c; HsT18717; kuz; MADM; CDw156; ADAM 10; kuzbanian protein homolog; mammalian disintegrin-metalloprotease; a disintegrin and metalloprotease domain 10; AD10; |
Gene ID | 102 |
mRNA Refseq | NM_001110 |
Protein Refseq | NP_001101 |
MIM | 602192 |
UniProt ID | O14672 |
◆ Recombinant Proteins | ||
ADAM10-18H | Active Recombinant Human ADAM10, His-tagged | +Inquiry |
ADAM10-924H | Active Recombinant Human ADAM10 Protein, His-tagged | +Inquiry |
ADAM10-2422H | Recombinant Human ADAM10 protein, GST-tagged | +Inquiry |
ADAM10-75H | Recombinant Human ADAM10 protein, His&hFc-tagged | +Inquiry |
ADAM10-74H | Recombinant Human ADAM10 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ADAM10-13H | Active Recombinant Human ADAM10 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM10 Products
Required fields are marked with *
My Review for All ADAM10 Products
Required fields are marked with *