Recombinant Human ADAM7 protein, His-tagged
Cat.No. : | ADAM7-3790H |
Product Overview : | Recombinant Human ADAM7 protein(134-483 aa), fused to His tag, was expressed in E. coli. |
Availability | August 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 134-483 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | IKDLLPDTNIIANRMAHQLGHNLGMQHDEFPCTCPSGKCVMDSDGSIPALKFSKCSQNQYHQYLKDYKPTCMLNIPFPYNFHDFQFCGNKKLDEGEECDCGPAQECTNPCCDAHTCVLKPGFTCAEGECCESCQIKKAGSICRPAKDECDFPEMCTGHSPACPKDQFRVNGFPCKNSEGYCFMGKCPTREDQCSELFDDEAIESHDICYKMNTKGNKFGYCKNKENRFLPCEEKDVRCGKIYCTGGELSSLLGEDKTYHLKDPQKNATVKCKTIFLYHDSTDIGLVASGTKCGEGMVCNNGECLNMEKVYISTNCPSQCNENPVDGHGLQCHCEEGQAPVACEETLHVTN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ADAM7 ADAM metallopeptidase domain 7 [ Homo sapiens ] |
Official Symbol | ADAM7 |
Synonyms | ADAM7; ADAM metallopeptidase domain 7; a disintegrin and metalloproteinase domain 7; disintegrin and metalloproteinase domain-containing protein 7; EAPI; GP 83; epididymal apical protein I; sperm maturation-related glycoprotein GP-83; GP83; GP-83; ADAM 7; ADAM-7; |
Gene ID | 8756 |
mRNA Refseq | NM_003817 |
Protein Refseq | NP_003808 |
MIM | 607310 |
UniProt ID | Q9H2U9 |
◆ Recombinant Proteins | ||
ADAM7-3790H | Recombinant Human ADAM7 protein, His-tagged | +Inquiry |
ADAM7-319M | Recombinant Mouse ADAM7 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAM7-889HF | Recombinant Full Length Human ADAM7 Protein, GST-tagged | +Inquiry |
ADAM7-161R | Recombinant Rat ADAM7 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL-10047MF | Recombinant Full Length Mouse Disintegrin And Metalloproteinase Domain-Containing Protein 7(Adam7) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM7-25HCL | Recombinant Human ADAM7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM7 Products
Required fields are marked with *
My Review for All ADAM7 Products
Required fields are marked with *