Recombinant Human ADAM7 protein, His-tagged

• Cat.No.: ADAM7-3790H
• Product Overview: Recombinant Human ADAM7 protein(134-483 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 134-483 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: IKDLLPDTNIIANRMAHQLGHNLGMQHDEFPCTCPSGKCVMDSDGSIPALKFSKCSQNQYHQYLKDYKPTCMLNIPFPYNFHDFQFCGNKKLDEGEECDCGPAQECTNPCCDAHTCVLKPGFTCAEGECCESCQIKKAGSICRPAKDECDFPEMCTGHSPACPKDQFRVNGFPCKNSEGYCFMGKCPTREDQCSELFDDEAIESHDICYKMNTKGNKFGYCKNKENRFLPCEEKDVRCGKIYCTGGELSSLLGEDKTYHLKDPQKNATVKCKTIFLYHDSTDIGLVASGTKCGEGMVCNNGECLNMEKVYISTNCPSQCNENPVDGHGLQCHCEEGQAPVACEETLHVTN
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ADAM7 ADAM metallopeptidase domain 7 [ Homo sapiens ]
• Official Symbol: ADAM7
• Synonyms: ADAM7; ADAM metallopeptidase domain 7; a disintegrin and metalloproteinase domain 7; disintegrin and metalloproteinase domain-containing protein 7; EAPI; GP 83; epididymal apical protein I; sperm maturation-related glycoprotein GP-83; GP83; GP-83; ADAM 7; ADAM-7
• Gene ID: 8756
• mRNA Refseq: NM_003817
• Protein Refseq: NP_003808
• MIM: 607310
• UniProt ID: Q9H2U9