Recombinant Human ADAMDEC1 Protein, GST-tagged
| Cat.No. : | ADAMDEC1-294H |
| Product Overview : | Human ADAMDEC1 partial ORF ( NP_055294, 361 a.a. - 470 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their interactions with germinal center T cells. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADAMDEC1 ADAM-like, decysin 1 [ Homo sapiens ] |
| Official Symbol | ADAMDEC1 |
| Synonyms | ADAMDEC1; ADAM-like, decysin 1; ADAM DEC1; M12.219; decysin; disintegrin protease; ADAM-like protein decysin-1; a disintegrin and metalloproteinase domain-like protein decysin-1; FLJ79219; |
| Gene ID | 27299 |
| mRNA Refseq | NM_001145271 |
| Protein Refseq | NP_001138743 |
| MIM | 606393 |
| UniProt ID | O15204 |
| ◆ Recombinant Proteins | ||
| ADAMDEC1-485H | Recombinant Human ADAMDEC1 Protein, His-tagged | +Inquiry |
| ADAMDEC1-3148H | Recombinant Human ADAMDEC1, His-tagged | +Inquiry |
| ADAMDEC1-294H | Recombinant Human ADAMDEC1 Protein, GST-tagged | +Inquiry |
| ADAMDEC1-0437H | Recombinant Human ADAMDEC1 Protein (Lys206-Glu470), C-His-tagged | +Inquiry |
| ADAMDEC1-9384H | Recombinant Human ADAMDEC1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMDEC1 Products
Required fields are marked with *
My Review for All ADAMDEC1 Products
Required fields are marked with *
