Recombinant Human ADAMDEC1 Protein, His-tagged
Cat.No. : | ADAMDEC1-485H |
Product Overview : | Recombinant Human ADAMDEC1, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | THis encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. THis protein may play an important role in dendritic cell function and their interactions with germinal center T cells. |
Form : | Supplied as a 0.2 µM filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM ZnCl2, pH7.5 |
Molecular Mass : | 50.4kD |
AA Sequence : | IAIKQTPELTLHEIVCPKKLHILHKREIKNNQTEKHGKEERYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASISTCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTEVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | ADAMDEC1 ADAM-like, decysin 1 [ Homo sapiens ] |
Official Symbol | ADAMDEC1 |
Synonyms | ADAMDEC1; ADAM-like, decysin 1; ADAM DEC1; M12.219; decysin; disintegrin protease; ADAM-like protein decysin-1; a disintegrin and metalloproteinase domain-like protein decysin-1; FLJ79219; |
Gene ID | 27299 |
mRNA Refseq | NM_001145271 |
Protein Refseq | NP_001138743 |
MIM | 606393 |
UniProt ID | O15204 |
◆ Recombinant Proteins | ||
ADAMDEC1-294H | Recombinant Human ADAMDEC1 Protein, GST-tagged | +Inquiry |
ADAMDEC1-0437H | Recombinant Human ADAMDEC1 Protein (Lys206-Glu470), C-His-tagged | +Inquiry |
ADAMDEC1-3148H | Recombinant Human ADAMDEC1, His-tagged | +Inquiry |
ADAMDEC1-485H | Recombinant Human ADAMDEC1 Protein, His-tagged | +Inquiry |
ADAMDEC1-9384H | Recombinant Human ADAMDEC1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMDEC1 Products
Required fields are marked with *
My Review for All ADAMDEC1 Products
Required fields are marked with *