Recombinant Human ADAMDEC1 Protein, His-tagged

Cat.No. : ADAMDEC1-485H
Product Overview : Recombinant Human ADAMDEC1, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : THis encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. THis protein may play an important role in dendritic cell function and their interactions with germinal center T cells.
Form : Supplied as a 0.2 µM filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM ZnCl2, pH7.5
Molecular Mass : 50.4kD
AA Sequence : IAIKQTPELTLHEIVCPKKLHILHKREIKNNQTEKHGKEERYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASISTCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTEVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name ADAMDEC1 ADAM-like, decysin 1 [ Homo sapiens ]
Official Symbol ADAMDEC1
Synonyms ADAMDEC1; ADAM-like, decysin 1; ADAM DEC1; M12.219; decysin; disintegrin protease; ADAM-like protein decysin-1; a disintegrin and metalloproteinase domain-like protein decysin-1; FLJ79219;
Gene ID 27299
mRNA Refseq NM_001145271
Protein Refseq NP_001138743
MIM 606393
UniProt ID O15204

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMDEC1 Products

Required fields are marked with *

My Review for All ADAMDEC1 Products

Required fields are marked with *

0
cart-icon