Recombinant Human ADAMTS1 Protein, GST-tagged

Cat.No. : ADAMTS1-296H
Product Overview : Human ADAMTS1 partial ORF ( AAH36515, 858 a.a. - 967 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene contains two disintegrin loops and three C-terminal TS motifs and has anti-angiogenic activity. The expression of this gene may be associated with various inflammatory processes as well as development of cancer cachexia. This gene is likely to be necessary for normal growth, fertility, and organ morphology and function. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.84 kDa
AA Sequence : WVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPASTRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDFCTMAECS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADAMTS1 ADAM metallopeptidase with thrombospondin type 1 motif, 1 [ Homo sapiens ]
Official Symbol ADAMTS1
Synonyms ADAMTS1; ADAM metallopeptidase with thrombospondin type 1 motif, 1; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1; A disintegrin and metalloproteinase with thrombospondin motifs 1; C3 C5; KIAA1346; METH1; METH-1; ADAM-TS1; ADAMTS-1; ADAM-TS 1; human metalloproteinase with thrombospondin type 1 motifs; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1; C3-C5;
Gene ID 9510
mRNA Refseq NM_006988
Protein Refseq NP_008919
MIM 605174
UniProt ID Q9UHI8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMTS1 Products

Required fields are marked with *

My Review for All ADAMTS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon