Recombinant Human ADAMTS1 Protein, GST-tagged
Cat.No. : | ADAMTS1-296H |
Product Overview : | Human ADAMTS1 partial ORF ( AAH36515, 858 a.a. - 967 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene contains two disintegrin loops and three C-terminal TS motifs and has anti-angiogenic activity. The expression of this gene may be associated with various inflammatory processes as well as development of cancer cachexia. This gene is likely to be necessary for normal growth, fertility, and organ morphology and function. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | WVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPASTRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDFCTMAECS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADAMTS1 ADAM metallopeptidase with thrombospondin type 1 motif, 1 [ Homo sapiens ] |
Official Symbol | ADAMTS1 |
Synonyms | ADAMTS1; ADAM metallopeptidase with thrombospondin type 1 motif, 1; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1; A disintegrin and metalloproteinase with thrombospondin motifs 1; C3 C5; KIAA1346; METH1; METH-1; ADAM-TS1; ADAMTS-1; ADAM-TS 1; human metalloproteinase with thrombospondin type 1 motifs; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1; C3-C5; |
Gene ID | 9510 |
mRNA Refseq | NM_006988 |
Protein Refseq | NP_008919 |
MIM | 605174 |
UniProt ID | Q9UHI8 |
◆ Recombinant Proteins | ||
Adamts1-2049M | Recombinant Mouse Adamts1 protein, His-tagged | +Inquiry |
ADAMTS1-2048H | Recombinant Human ADAMTS1 protein, His-tagged | +Inquiry |
ADAMTS1-234R | Recombinant Rhesus monkey ADAMTS1 Protein, His-tagged | +Inquiry |
Adamts1-2050R | Recombinant Rat Adamts1 protein, His-tagged | +Inquiry |
ADAMTS1-296H | Recombinant Human ADAMTS1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAMTS1 Products
Required fields are marked with *
My Review for All ADAMTS1 Products
Required fields are marked with *
0
Inquiry Basket