Recombinant Human ADAMTS12 Protein, GST-tagged
| Cat.No. : | ADAMTS12-298H |
| Product Overview : | Human ADAMTS12 full-length ORF ( AAH58841.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS-1) motif. Individual members of this family differ in the number of C-terminal TS-1 motifs, and some have unique C-terminal domains. The enzyme encoded by this gene contains eight TS-1 motifs. It may play roles in pulmonary cells during fetal development or in tumor processes through its proteolytic activity or as a molecule potentially involved in regulation of cell adhesion. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 52.4 kDa |
| AA Sequence : | MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRVDASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETKEPTCGLKGIVTHMSSWVEESVLFFW |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADAMTS12 ADAM metallopeptidase with thrombospondin type 1 motif, 12 [ Homo sapiens ] |
| Official Symbol | ADAMTS12 |
| Synonyms | ADAMTS12; ADAM metallopeptidase with thrombospondin type 1 motif, 12; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 12; A disintegrin and metalloproteinase with thrombospondin motifs 12; ADAM-TS12; ADAMTS-12; ADAM-TS 12; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 12; PRO4389; |
| Gene ID | 81792 |
| mRNA Refseq | NM_030955 |
| Protein Refseq | NP_112217 |
| MIM | 606184 |
| UniProt ID | P58397 |
| ◆ Recombinant Proteins | ||
| ADAMTS12-916HF | Recombinant Full Length Human ADAMTS12 Protein, GST-tagged | +Inquiry |
| ADAMTS12-298H | Recombinant Human ADAMTS12 Protein, GST-tagged | +Inquiry |
| ADAMTS12-1485H | Recombinant Human ADAMTS12 protein, His-tagged | +Inquiry |
| ADAMTS12-3006M | Recombinant Mouse ADAMTS12, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS12 Products
Required fields are marked with *
My Review for All ADAMTS12 Products
Required fields are marked with *
