Recombinant Human ADAMTS12 Protein, GST-tagged

Cat.No. : ADAMTS12-298H
Product Overview : Human ADAMTS12 full-length ORF ( AAH58841.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS-1) motif. Individual members of this family differ in the number of C-terminal TS-1 motifs, and some have unique C-terminal domains. The enzyme encoded by this gene contains eight TS-1 motifs. It may play roles in pulmonary cells during fetal development or in tumor processes through its proteolytic activity or as a molecule potentially involved in regulation of cell adhesion. [provided by RefSeq, Jul 2008]
Molecular Mass : 52.4 kDa
AA Sequence : MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRVDASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETKEPTCGLKGIVTHMSSWVEESVLFFW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADAMTS12 ADAM metallopeptidase with thrombospondin type 1 motif, 12 [ Homo sapiens ]
Official Symbol ADAMTS12
Synonyms ADAMTS12; ADAM metallopeptidase with thrombospondin type 1 motif, 12; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 12; A disintegrin and metalloproteinase with thrombospondin motifs 12; ADAM-TS12; ADAMTS-12; ADAM-TS 12; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 12; PRO4389;
Gene ID 81792
mRNA Refseq NM_030955
Protein Refseq NP_112217
MIM 606184
UniProt ID P58397

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMTS12 Products

Required fields are marked with *

My Review for All ADAMTS12 Products

Required fields are marked with *

0
cart-icon