Recombinant Human ADAMTS14 protein, GST-tagged
Cat.No. : | ADAMTS14-2422H |
Product Overview : | Recombinant Human ADAMTS14 protein(1086-1223 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1086-1223 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | HRLCCVSCIKKASGPNPGPDPGPTSLPPFSTPGSPLPGPQDPADAAEPPGKPTGSEDHQHGRATQLPGALDTSSPGTQHPFAPETPIPGASWSISPTTPGGLPWGWTQTPTPVPEDKGQPGEDLRHPGTSLPAASPVT |
Gene Name | ADAMTS14 ADAM metallopeptidase with thrombospondin type 1 motif, 14 [ Homo sapiens ] |
Official Symbol | ADAMTS14 |
Synonyms | ADAMTS14; ADAM metallopeptidase with thrombospondin type 1 motif, 14; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 14; A disintegrin and metalloproteinase with thrombospondin motifs 14; ADAM-TS14; ADAMTS-14; ADAM-TS 14; metalloprotease-disintegrin protease; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 14; FLJ32820; |
Gene ID | 140766 |
mRNA Refseq | NM_080722 |
Protein Refseq | NP_542453 |
MIM | 607506 |
UniProt ID | Q8WXS8 |
◆ Recombinant Proteins | ||
ADAMTS14-654H | Recombinant Human ADAMTS14 protein, His-tagged | +Inquiry |
ADAMTS14-2422H | Recombinant Human ADAMTS14 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS14 Products
Required fields are marked with *
My Review for All ADAMTS14 Products
Required fields are marked with *