Recombinant Human ADAMTS14 protein, His-tagged
Cat.No. : | ADAMTS14-654H |
Product Overview : | Recombinant Human ADAMTS14 protein(Q8WXS8)(253-555aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 253-555a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | HAKPGSYSIEVLLVVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESLGVHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPSHAEHHDHVVFLTRQDFGPSGYAPVTGMCHPLRSCALNHEDGFSSAFVIAHETGHVLGMEHDGQGNGCADETSLGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFDPAWPQPPELPGINYSMDEQCRFDFGSGYQTCLAFRTFEPCKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFKGHCIWKSPEQTYGQDGGW |
Gene Name | ADAMTS14 ADAM metallopeptidase with thrombospondin type 1 motif, 14 [ Homo sapiens ] |
Official Symbol | ADAMTS14 |
Synonyms | ADAMTS14; ADAM metallopeptidase with thrombospondin type 1 motif, 14; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 14; A disintegrin and metalloproteinase with thrombospondin motifs 14; ADAM-TS14; ADAMTS-14; ADAM-TS 14; metalloprotease-disintegrin protease; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 14; FLJ32820; |
Gene ID | 140766 |
mRNA Refseq | NM_080722 |
Protein Refseq | NP_542453 |
MIM | 607506 |
UniProt ID | Q8WXS8 |
◆ Recombinant Proteins | ||
ADAMTS14-2422H | Recombinant Human ADAMTS14 protein, GST-tagged | +Inquiry |
ADAMTS14-654H | Recombinant Human ADAMTS14 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS14 Products
Required fields are marked with *
My Review for All ADAMTS14 Products
Required fields are marked with *