Recombinant Human ADAMTS14 protein, His-tagged

• Cat.No.: ADAMTS14-654H
• Product Overview: Recombinant Human ADAMTS14 protein(Q8WXS8)(253-555aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 253-555a.a.
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: HAKPGSYSIEVLLVVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESLGVHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPSHAEHHDHVVFLTRQDFGPSGYAPVTGMCHPLRSCALNHEDGFSSAFVIAHETGHVLGMEHDGQGNGCADETSLGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFDPAWPQPPELPGINYSMDEQCRFDFGSGYQTCLAFRTFEPCKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFKGHCIWKSPEQTYGQDGGW

Gene Information

• Gene Name: ADAMTS14 ADAM metallopeptidase with thrombospondin type 1 motif, 14 [ Homo sapiens ]
• Official Symbol: ADAMTS14
• Synonyms: ADAMTS14; ADAM metallopeptidase with thrombospondin type 1 motif, 14; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 14; A disintegrin and metalloproteinase with thrombospondin motifs 14; ADAM-TS14; ADAMTS-14; ADAM-TS 14; metalloprotease-disintegrin protease; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 14; FLJ32820
• Gene ID: 140766
• mRNA Refseq: NM_080722
• Protein Refseq: NP_542453
• MIM: 607506
• UniProt ID: Q8WXS8