Recombinant Human ADAMTS17 Protein, GST-tagged
Cat.No. : | ADAMTS17-301H |
Product Overview : | Human ADAMTS17 partial ORF ( NP_620688, 543 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature protein, which may promote breast cancer cell growth and survival. Mutations in this gene are associated with a Weill-Marchesani-like syndrome, which is characterized by lenticular myopia, ectopia lentis, glaucoma, spherophakia, and short stature. [provided by RefSeq, May 2016] |
Molecular Mass : | 37.62 kDa |
AA Sequence : | DGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVAD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADAMTS17 ADAM metallopeptidase with thrombospondin type 1 motif, 17 [ Homo sapiens ] |
Official Symbol | ADAMTS17 |
Synonyms | ADAMTS17; ADAM metallopeptidase with thrombospondin type 1 motif, 17; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 17; A disintegrin and metalloproteinase with thrombospondin motifs 17; FLJ16363; FLJ32769; ADAM-TS17; ADAMTS-17; ADAM-TS 17; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 17; |
Gene ID | 170691 |
mRNA Refseq | NM_139057 |
Protein Refseq | NP_620688 |
MIM | 607511 |
UniProt ID | Q8TE56 |
◆ Recombinant Proteins | ||
ADAMTS17-301H | Recombinant Human ADAMTS17 Protein, GST-tagged | +Inquiry |
ADAMTS17-16H | Recombinant Human ADAMTS17 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS17 Products
Required fields are marked with *
My Review for All ADAMTS17 Products
Required fields are marked with *