Recombinant Human ADAMTS17 Protein, GST-tagged

Cat.No. : ADAMTS17-301H
Product Overview : Human ADAMTS17 partial ORF ( NP_620688, 543 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature protein, which may promote breast cancer cell growth and survival. Mutations in this gene are associated with a Weill-Marchesani-like syndrome, which is characterized by lenticular myopia, ectopia lentis, glaucoma, spherophakia, and short stature. [provided by RefSeq, May 2016]
Molecular Mass : 37.62 kDa
AA Sequence : DGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVAD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADAMTS17 ADAM metallopeptidase with thrombospondin type 1 motif, 17 [ Homo sapiens ]
Official Symbol ADAMTS17
Synonyms ADAMTS17; ADAM metallopeptidase with thrombospondin type 1 motif, 17; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 17; A disintegrin and metalloproteinase with thrombospondin motifs 17; FLJ16363; FLJ32769; ADAM-TS17; ADAMTS-17; ADAM-TS 17; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 17;
Gene ID 170691
mRNA Refseq NM_139057
Protein Refseq NP_620688
MIM 607511
UniProt ID Q8TE56

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMTS17 Products

Required fields are marked with *

My Review for All ADAMTS17 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon